MCM3 Antibody (3E11)


Western Blot: MCM3 Antibody (3E11) [H00004172-M06] - Analysis of MCM3 expression in human spleen.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

MCM3 Antibody (3E11) Summary

MCM3 (NP_002379, 26 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVS
MCM3 - MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) (3E11)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCM3 Antibody (3E11)

  • cervical cancer proto-oncogene 5
  • DNA polymerase alpha holoenzyme-associated protein P1
  • DNA replication factor MCM3
  • DNA replication licensing factor MCM3
  • EC
  • HCC5
  • hRlf beta subunit
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae)
  • MCM3 minichromosome maintenance deficient 3
  • MGC1157
  • minichromosome maintenance complex component 3
  • minichromosome maintenance deficient (S. cerevisiae) 3
  • minichromosome maintenance deficient 3
  • P1.h
  • p102
  • P1-MCM3
  • replication licensing factor, beta subunit
  • RLF subunit beta
  • RLFB


The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ELISA

Publications for MCM3 Antibody (H00004172-M06) (0)

There are no publications for MCM3 Antibody (H00004172-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM3 Antibody (H00004172-M06) (0)

There are no reviews for MCM3 Antibody (H00004172-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM3 Antibody (H00004172-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MCM3 Products

Bioinformatics Tool for MCM3 Antibody (H00004172-M06)

Discover related pathways, diseases and genes to MCM3 Antibody (H00004172-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM3 Antibody (H00004172-M06)

Discover more about diseases related to MCM3 Antibody (H00004172-M06).

Pathways for MCM3 Antibody (H00004172-M06)

View related products by pathway.

PTMs for MCM3 Antibody (H00004172-M06)

Learn more about PTMs related to MCM3 Antibody (H00004172-M06).

Research Areas for MCM3 Antibody (H00004172-M06)

Find related products by research area.

Blogs on MCM3

There are no specific blogs for MCM3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MCM3 Antibody (3E11) and receive a gift card or discount.


Gene Symbol MCM3