MCM3 Antibody (3E11)

Western Blot: MCM3 Antibody (3E11) [H00004172-M06] - Analysis of MCM3 expression in human spleen.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3E11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

MCM3 Antibody (3E11) Summary

• Immunogen: MCM3 (NP_002379, 26 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVS
• Specificity: MCM3 - MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) (3E11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MCM3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCM3 Antibody (3E11)

• cervical cancer proto-oncogene 5
• DNA polymerase alpha holoenzyme-associated protein P1
• DNA replication factor MCM3
• DNA replication licensing factor MCM3
• EC 3.6.4.12
• HCC5
• hRlf beta subunit
• MCM3 minichromosome maintenance deficient 3 (S. cerevisiae)
• MCM3 minichromosome maintenance deficient 3
• MGC1157
• minichromosome maintenance complex component 3
• minichromosome maintenance deficient (S. cerevisiae) 3
• minichromosome maintenance deficient 3
• P1.h
• p102
• P1-MCM3
• replication licensing factor, beta subunit
• RLF subunit beta
• RLFB

Background

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MCM3
• Entrez:
  • 4172(Human)
• Uniprot:
  • NP_002379(Human)