MCAT Antibody - BSA Free

Images

 
Western Blot: MCAT Antibody [NBP3-35607] - Western blot analysis of lysates from LO2 cells, using MCAT Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

MCAT Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit MCAT Antibody - BSA Free (NBP3-35607) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 191-390 of human MCAT (NP_775738.3).

Sequence:
SGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCAT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500 - 1:2000
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for MCAT Antibody - BSA Free

  • EC 2.3.1.39
  • fabD
  • FASN2C
  • malonyl CoA:ACP acyltransferase (mitochondrial)
  • malonyl-CoA:acyl carrier protein transacylase, mitochondrial
  • malonyl-CoA-acyl carrier protein transacylase, mitochondrial
  • MCT[Acyl-carrier-protein] malonyltransferase
  • Mitochondrial malonyltransferase
  • MTMGC47838
  • NET62

Background

MCAT is encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00004502-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP3-12238
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
H00004489-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-33660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB100-791
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-03626
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF5066
Species: Hu
Applications: WB
NBP1-82617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-33860
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-35607
Species: Hu
Applications: WB, ELISA

Publications for MCAT Antibody (NBP3-35607) (0)

There are no publications for MCAT Antibody (NBP3-35607).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCAT Antibody (NBP3-35607) (0)

There are no reviews for MCAT Antibody (NBP3-35607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCAT Antibody (NBP3-35607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCAT Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MCAT