MBD3L1 Antibody

Western Blot: MBD3L1 Antibody [NBP2-30753] - Analysis in control (vector only transfected HEK293T lysate) and MBD3L1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: MBD3L1 Antibody [NBP2-30753] - Staining of human testis shows strong nuclear and cytoplasmic staining in seminiferous duct cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MBD3L1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBD3L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MBD3L1 Protein (NBP2-30753PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MBD3L1 Antibody

• MBD3L
• MBD3-like protein 1
• methyl-CpG binding domain protein 3-like 1
• methyl-CpG binding domain protein 3-like
• methyl-CpG-binding domain protein 3-like 1
• MGC138263
• MGC138269

Background

MBD3L1 encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MBD3L1
• Uniprot:
  • Q8WWY6(Human)