MBD3L1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MBD3L1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MBD3L1 Antibody
Background
MBD3L1 encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC, IHC-P
Publications for MBD3L1 Antibody (NBP2-30753) (0)
There are no publications for MBD3L1 Antibody (NBP2-30753).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MBD3L1 Antibody (NBP2-30753) (0)
There are no reviews for MBD3L1 Antibody (NBP2-30753).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MBD3L1 Antibody (NBP2-30753) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MBD3L1 Products
Bioinformatics Tool for MBD3L1 Antibody (NBP2-30753)
Discover related pathways, diseases and genes to MBD3L1 Antibody (NBP2-30753). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MBD3L1 Antibody (NBP2-30753)
Discover more about diseases related to MBD3L1 Antibody (NBP2-30753).
| | Pathways for MBD3L1 Antibody (NBP2-30753)
View related products by pathway.
|
PTMs for MBD3L1 Antibody (NBP2-30753)
Learn more about PTMs related to MBD3L1 Antibody (NBP2-30753).
|
Blogs on MBD3L1