We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MAX binding protein Recombinant Protein Antigen

Images

 
There are currently no images for MAX binding protein Recombinant Protein Antigen (NBP2-56563PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MAX binding protein Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAX binding protein.

Source: E. coli

Amino Acid Sequence: SIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MNT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56563.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAX binding protein Recombinant Protein Antigen

  • BHLHD3
  • bHLHd3Max-interacting protein
  • Class D basic helix-loop-helix protein 3
  • MAD6
  • MAX binding protein
  • MXD6
  • Myc antagonist MNT
  • Protein ROX
  • ROXmax-binding protein MNT

Background

MNT, also known as MAX-binding protein MNT, is a 582 amino acid protein that is 62 kDa, has a basic-Helix-Loop-Helix-zipper domain (bHLHzip) with which it binds the canonical DNA sequence CANNTG, known as the E box, following heterodimerization with Max proteins. This protein is likely a transcriptional repressor and an antagonist of Myc-dependent transcriptional activation and cell growth and represses transcription by binding to DNA binding proteins at its N-terminal Sin3-interaction domain. Current research is being performed on several diseases and disorders including Miller-Dieker lissencephaly, Miller-Dieker syndrome, Williams-Beuren syndrome, tetanus neonatorum, rheumatic fever, lissencephaly, tetanus, cholestasis, rabies, medulloblastoma, lung cancer, neuroblastoma, and leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-793
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-89979
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, PLA, Simple Western, WB
NBP1-52105
Species: Hu, Rt
Applications: Flow, IHC,  IHC-P, PEP-ELISA, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84254
Species: Hu
Applications: IHC,  IHC-P
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32775
Species: Hu, Mar, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-46060
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4185
Species: Hu
Applications: ICC
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP3-19989
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB

Publications for MAX binding protein Recombinant Protein Antigen (NBP2-56563PEP) (0)

There are no publications for MAX binding protein Recombinant Protein Antigen (NBP2-56563PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAX binding protein Recombinant Protein Antigen (NBP2-56563PEP) (0)

There are no reviews for MAX binding protein Recombinant Protein Antigen (NBP2-56563PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAX binding protein Recombinant Protein Antigen (NBP2-56563PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAX binding protein Products

Research Areas for MAX binding protein Recombinant Protein Antigen (NBP2-56563PEP)

Find related products by research area.

Blogs on MAX binding protein

There are no specific blogs for MAX binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAX binding protein Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MNT