MAVS Recombinant Protein Antigen

Images

 
There are currently no images for MAVS Protein (NBP2-38613PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MAVS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAVS.

Source: E. coli

Amino Acid Sequence: PVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAVS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38613.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAVS Recombinant Protein Antigen

  • CARD adapter inducing interferon beta
  • CARD adapter inducing interferon-beta
  • CARD adaptor inducing IFN-beta
  • Cardif
  • DKFZp547C224
  • DKFZp666M015
  • FLJ27482
  • IFN-B promoter stimulator 1
  • Interferon beta promoter stimulator protein 1
  • interferon-beta promoter stimulator protein 1
  • IPS-1
  • IPS-1FLJ41962
  • IPS1MGC3260
  • KIAA1271FLJ35386
  • MAVS
  • mitochondrial antiviral signaling protein
  • mitochondrial antiviral-signaling protein
  • mitochondrial viral signaling protein
  • Putative NF-kappa-B-activating protein 031N
  • virus-induced signaling adapter variant 1b
  • virus-induced signaling adaptor variant 1a
  • Virus-induced-signaling adapter
  • VISA
  • VISAFLJ38051

Background

Double-stranded RNA viruses are recognized in a cell type-dependent manner by the transmembrane receptor TLR3 (MIM 603029) or by the cytoplasmic RNA helicases MDA5 (MIM 606951) and RIGI (ROBO3; MIM 608630). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK; MIM 600664) and IKKB (IKBKB; MIM 603258), which activate NFKB (see MIM 164011), or TBK1 (MIM 604834) and IKKE (IKBKE; MIM 605048), which activate IRF3 (MIM 603734). Activated IRF3 and NFKB induce transcription of IFNB (IFNB1; MIM 147640). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1; MIM 607601). For RIGI, the intermediary protein is mitochondria-bound IPS1 (Sen and Sarkar, 2005).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC,  IHC-P, PEP-ELISA
8499-IF
Species: Hu
Applications: BA
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-85348
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1207
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo

Publications for MAVS Protein (NBP2-38613PEP) (0)

There are no publications for MAVS Protein (NBP2-38613PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAVS Protein (NBP2-38613PEP) (0)

There are no reviews for MAVS Protein (NBP2-38613PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAVS Protein (NBP2-38613PEP). (Showing 1 - 1 of 1 FAQ).

  1. Molecular weight of MAVS?
    • MAVS is a 540 aa protein with a predicted size of 56 kDa.

Additional MAVS Products

Research Areas for MAVS Protein (NBP2-38613PEP)

Find related products by research area.

Blogs on MAVS.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAVS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAVS