Matriptase 2 Antibody

Images

 
Western Blot: Matriptase 2 Antibody [NBP1-57098] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: Matriptase 2 Antibody [NBP1-57098] - Human Liver tissue, 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Matriptase 2 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMPRSS6(transmembrane protease, serine 6) The peptide sequence was selected from the N terminal of TMPRSS6. Peptide sequence LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMPRSS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TMPRSS6 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Matriptase 2 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • FLJ30744
  • IRIDA
  • Matriptase-2
  • membrane-bound mosaic serine proteinase matriptase-2
  • transmembrane protease serine 6
  • transmembrane protease, serine 6
  • type II transmembrane serine protease 6

Background

TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.The protein encoded by this gene is a type II transmembrane serine proteinase that is found attached to the cell surface. The encoded protein may be involved in matrix remodeling processes in the liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59337
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
AF3720
Species: Hu, Mu
Applications: ICC, WB
NBP1-57098
Species: Hu
Applications: IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
507-BP/CF
Species: Hu
Applications: BA
MAB3120
Species: Hu
Applications: Simple Western, WB
MEP00B
Species: Mu
Applications: ELISA
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84071
Species: Hu
Applications: IHC, IHC-P, WB
AF1927
Species: Hu
Applications: ICC, IP, WB
NBP2-01625
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
AF7509
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-57098
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Matriptase 2 Antibody (NBP1-57098) (0)

There are no publications for Matriptase 2 Antibody (NBP1-57098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Matriptase 2 Antibody (NBP1-57098) (0)

There are no reviews for Matriptase 2 Antibody (NBP1-57098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Matriptase 2 Antibody (NBP1-57098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Matriptase 2 Products

Bioinformatics Tool for Matriptase 2 Antibody (NBP1-57098)

Discover related pathways, diseases and genes to Matriptase 2 Antibody (NBP1-57098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Matriptase 2 Antibody (NBP1-57098)

Discover more about diseases related to Matriptase 2 Antibody (NBP1-57098).
 

Pathways for Matriptase 2 Antibody (NBP1-57098)

View related products by pathway.

PTMs for Matriptase 2 Antibody (NBP1-57098)

Learn more about PTMs related to Matriptase 2 Antibody (NBP1-57098).
 

Research Areas for Matriptase 2 Antibody (NBP1-57098)

Find related products by research area.

Blogs on Matriptase 2

There are no specific blogs for Matriptase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Matriptase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS6
Uniprot