MATK Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC |
Predicted Species |
Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MATK |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for MATK Antibody - BSA Free
Background
MATK, or Megakaryocyte-Associated Tyrosine-Protein Kinase, contains three isoforms that are 56 kDa, 57 kDa, and 52 kDa, and is involved in the regulation of tyrosine kinase and the inhibition of T-cell proliferation. MATK may play a role in signaling in certain types of breast cancer, and the protein is currently being used in research of a variety of diseases and disorders, including macular degeneration, endocarditis, neuroblastoma, colon cancer, ataxia, pharyngitis, pancreatitis, and pancreatic cancer. MATK is linked to the Kit Receptor signaling pathway, the IL-3 signaling pathway, the Neurotrophin signaling pathway, and ERBB2 signaling, through which it interacts with ERBB2, PTK2B, EWSR1, PXN, and SRC.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Publications for MATK Antibody (NBP3-17887) (0)
There are no publications for MATK Antibody (NBP3-17887).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MATK Antibody (NBP3-17887) (0)
There are no reviews for MATK Antibody (NBP3-17887).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MATK Antibody (NBP3-17887) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MATK Products
Research Areas for MATK Antibody (NBP3-17887)
Find related products by research area.
|
Blogs on MATK