MAT2B Antibody

Western Blot: MAT2B Antibody [NBP1-82798] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a more
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82798] - Staining of human kidney shows moderate cytoplasmic, membranous and nuclear positivity in tubular cells.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

MAT2B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
MAT2B Protein (NBP1-82798PEP)

Alternate Names for MAT2B Antibody

  • beta regulatory subunit of methionine adenosyltransferase
  • DTDP-4-keto-6-deoxy-D-glucose 4-reductase
  • MAT II beta
  • MAT-II
  • MATIIbeta
  • methionine adenosyltransferase 2 subunit beta
  • Methionine adenosyltransferase II beta
  • methionine adenosyltransferase II, beta
  • MGC12237
  • Nbla02999
  • putative protein product of Nbla02999
  • SDR23E1
  • short chain dehydrogenase/reductase family 23E, member 1
  • TGR

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Ye
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Dr, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
Species: Hu, Mouse, Rat
Applications: WB, IHC, IHC-P

Publications for MAT2B Antibody (NBP1-82798) (0)

There are no publications for MAT2B Antibody (NBP1-82798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAT2B Antibody (NBP1-82798) (0)

There are no reviews for MAT2B Antibody (NBP1-82798). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAT2B Antibody (NBP1-82798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional MAT2B Antibody Products

Related Products by Gene

Bioinformatics Tool for MAT2B Antibody (NBP1-82798)

Discover related pathways, diseases and genes to MAT2B Antibody (NBP1-82798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAT2B Antibody (NBP1-82798)

Discover more about diseases related to MAT2B Antibody (NBP1-82798).

Pathways for MAT2B Antibody (NBP1-82798)

View related products by pathway.

PTMs for MAT2B Antibody (NBP1-82798)

Learn more about PTMs related to MAT2B Antibody (NBP1-82798).

Research Areas for MAT2B Antibody (NBP1-82798)

Find related products by research area.

Blogs on MAT2B.

MAT2a, MAT2b, HIF-1 alpha: Roles in Liver Cancer and DNA methylation
Methionine Adenosyltransferase II alpha, also known as MAT2a, is a catalytic subunit of methionine adenosyltransferase (MAT) and essential enzyme for the catalysis of the principle biological methyl donor, S-adenosylmethionine (SAM) from methionine an...  Read full blog post.

Contact Information

Product PDFs

Gene Symbol MAT2B

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-82798 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought