MAT2B Antibody


Western Blot: MAT2B Antibody [NBP1-82798] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82798] - Staining of human kidney shows moderate membranous positivity in cells in tubules and in glomeruli.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MAT2B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM
Specificity of human MAT2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
MAT2B Lysate (NBP2-65981)
Control Peptide
MAT2B Protein (NBP1-82798PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MAT2B Antibody

  • beta regulatory subunit of methionine adenosyltransferase
  • DTDP-4-keto-6-deoxy-D-glucose 4-reductase
  • MAT II beta
  • MAT-II
  • MATIIbeta
  • methionine adenosyltransferase 2 subunit beta
  • Methionine adenosyltransferase II beta
  • methionine adenosyltransferase II, beta
  • MGC12237
  • Nbla02999
  • putative protein product of Nbla02999
  • SDR23E1
  • short chain dehydrogenase/reductase family 23E, member 1
  • TGR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Ye
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MAT2B Antibody (NBP1-82798) (0)

There are no publications for MAT2B Antibody (NBP1-82798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAT2B Antibody (NBP1-82798) (0)

There are no reviews for MAT2B Antibody (NBP1-82798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAT2B Antibody (NBP1-82798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MAT2B Products

Bioinformatics Tool for MAT2B Antibody (NBP1-82798)

Discover related pathways, diseases and genes to MAT2B Antibody (NBP1-82798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAT2B Antibody (NBP1-82798)

Discover more about diseases related to MAT2B Antibody (NBP1-82798).

Pathways for MAT2B Antibody (NBP1-82798)

View related products by pathway.

PTMs for MAT2B Antibody (NBP1-82798)

Learn more about PTMs related to MAT2B Antibody (NBP1-82798).

Research Areas for MAT2B Antibody (NBP1-82798)

Find related products by research area.

Blogs on MAT2B.

MAT2a, MAT2b, HIF-1 alpha: Roles in Liver Cancer and DNA methylation
Methionine Adenosyltransferase II alpha, also known as MAT2a, is a catalytic subunit of methionine adenosyltransferase (MAT) and essential enzyme for the catalysis of the principle biological methyl donor, S-adenosylmethionine (SAM) from methionine an...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MAT2B Antibody and receive a gift card or discount.


Gene Symbol MAT2B