MAT2B Antibody - BSA Free

Western Blot: MAT2B Antibody [NBP1-82797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human skin shows no positivity in keratinocytes as expected.

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human duodenum shows moderate positivity in luminal membrane in glandular cells.

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human liver shows moderate positivity in bile canaliculi in hepatocytes.

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in astrocytes.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAT2B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAT2B Antibody - BSA Free (NBP1-82797) is a polyclonal antibody validated for use in IHC and WB. Anti-MAT2B Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAT2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  MAT2B Protein (NBP1-82797PEP)

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 20043323).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAT2B Antibody - BSA Free

• beta regulatory subunit of methionine adenosyltransferase
• DTDP-4-keto-6-deoxy-D-glucose 4-reductase
• MAT II beta
• MAT-II
• MATIIbeta
• methionine adenosyltransferase 2 subunit beta
• Methionine adenosyltransferase II beta
• methionine adenosyltransferase II, beta
• MGC12237
• Nbla02999
• putative protein product of Nbla02999
• SDR23E1
• short chain dehydrogenase/reductase family 23E, member 1
• TGR

Background

MAT2B is encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAT2B Antibody (NBP1-82797)(3)

Publications using NBP1-82797

• Kim J, Kim B, Kim SM et al. MicroRNA-203 impacts on the growth, aggressiveness and prognosis of hepatocellular carcinoma by targeting MAT2A and MAT2B genes Oncotarget 2019-04-19 [PMID: 31073374] (WB, Human)
• Xia M, Chen Y, Wang LC et al. Novel function and intracellular localization of methionine adenosyltransferase 2beta splicing variants. J Biol Chem 2010-06-25 [PMID: 20421296] (WB, Human)
• Ramani K, Yang H, Kuhlenkamp J et al. Changes in the expression of methionine adenosyltransferase genes and S-adenosylmethionine homeostasis during hepatic stellate cell activation. Hepatology 2010-03-01 [PMID: 20043323] (WB, Human, Rat)

Review for MAT2B Antibody (NBP1-82797) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Steve Smith WB Human 12/14/2014

Summary

• Application: Western Blot
• Sample Tested: Whole cell lysate prepared from RT-4 cells
• Species: Human

Bioinformatics

• Gene Symbol: MAT2B
• Entrez:
  • 27430(Human)
• Uniprot:
  • Q9NZL9(Human)