MAT2B Antibody

Images

 
Western Blot: MAT2B Antibody [NBP1-82797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human kidney shows strong membranous, cytoplasmic and nuclear positivity in cells of tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAT2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAT2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MAT2B Protein (NBP1-82797PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-82797 in the following applications:

Publications
Read Publications using
NBP1-82797 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAT2B Antibody

  • beta regulatory subunit of methionine adenosyltransferase
  • DTDP-4-keto-6-deoxy-D-glucose 4-reductase
  • MAT II beta
  • MAT-II
  • MATIIbeta
  • methionine adenosyltransferase 2 subunit beta
  • Methionine adenosyltransferase II beta
  • methionine adenosyltransferase II, beta
  • MGC12237
  • Nbla02999
  • putative protein product of Nbla02999
  • SDR23E1
  • short chain dehydrogenase/reductase family 23E, member 1
  • TGR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-82797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MAT2B Antibody (NBP1-82797)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
Rat
(1)
All Species

Review for MAT2B Antibody (NBP1-82797) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82797:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MAT2B NBP1-82797
Enlarge
reviewed by:
Steve Smith
WB Human 12/14/2014
View

Summary

ApplicationWestern Blot
Sample TestedWhole cell lysate prepared from RT-4 cells
SpeciesHuman

Blocking

Blocking DetailsPVDF was blocked with 5% milk in PBS buffer

Primary Anitbody

Dilution RatioPrimary antibody diluted 500 times in PBS buffer

Secondary Antibody

Secondary DescriptionBioRad goat anti-rabbit HRP
Secondary Manufacturer Cat#170-5046
Secondary Concentration20000 times diluted

Details

Detection NotesDeveloped using BioRad WesternC Chemiluminescence Kit, 30 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAT2B Antibody (NBP1-82797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAT2B Products

Bioinformatics Tool for MAT2B Antibody (NBP1-82797)

Discover related pathways, diseases and genes to MAT2B Antibody (NBP1-82797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAT2B Antibody (NBP1-82797)

Discover more about diseases related to MAT2B Antibody (NBP1-82797).
 

Pathways for MAT2B Antibody (NBP1-82797)

View related products by pathway.

PTMs for MAT2B Antibody (NBP1-82797)

Learn more about PTMs related to MAT2B Antibody (NBP1-82797).
 

Research Areas for MAT2B Antibody (NBP1-82797)

Find related products by research area.

Blogs on MAT2B.

MAT2a, MAT2b, HIF-1 alpha: Roles in Liver Cancer and DNA methylation
Methionine Adenosyltransferase II alpha, also known as MAT2a, is a catalytic subunit of methionine adenosyltransferase (MAT) and essential enzyme for the catalysis of the principle biological methyl donor, S-adenosylmethionine (SAM) from methionine an...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Steve Smith
12/14/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol MAT2B
Entrez
Uniprot