MAT2B Antibody


Western Blot: MAT2B Antibody [NBP1-82797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human kidney shows strong membranous, cytoplasmic and nuclear positivity in cells of tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MAT2B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Specificity of human MAT2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
MAT2B Lysate (NBP2-65981)
Control Peptide
MAT2B Protein (NBP1-82797PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-82797 in the following applications:

Read Publications using
NBP1-82797 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MAT2B Antibody

  • beta regulatory subunit of methionine adenosyltransferase
  • DTDP-4-keto-6-deoxy-D-glucose 4-reductase
  • MAT II beta
  • MAT-II
  • MATIIbeta
  • methionine adenosyltransferase 2 subunit beta
  • Methionine adenosyltransferase II beta
  • methionine adenosyltransferase II, beta
  • MGC12237
  • Nbla02999
  • putative protein product of Nbla02999
  • SDR23E1
  • short chain dehydrogenase/reductase family 23E, member 1
  • TGR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Ye
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MAT2B Antibody (NBP1-82797)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for MAT2B Antibody (NBP1-82797) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-82797:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot MAT2B NBP1-82797
reviewed by:
Steve Smith
WB Human 12/14/2014


ApplicationWestern Blot
Sample TestedWhole cell lysate prepared from RT-4 cells


Blocking DetailsPVDF was blocked with 5% milk in PBS buffer

Primary Anitbody

Dilution RatioPrimary antibody diluted 500 times in PBS buffer

Secondary Antibody

Secondary DescriptionBioRad goat anti-rabbit HRP
Secondary Manufacturer Cat#170-5046
Secondary Concentration20000 times diluted


Detection NotesDeveloped using BioRad WesternC Chemiluminescence Kit, 30 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAT2B Antibody (NBP1-82797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MAT2B Products

Bioinformatics Tool for MAT2B Antibody (NBP1-82797)

Discover related pathways, diseases and genes to MAT2B Antibody (NBP1-82797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAT2B Antibody (NBP1-82797)

Discover more about diseases related to MAT2B Antibody (NBP1-82797).

Pathways for MAT2B Antibody (NBP1-82797)

View related products by pathway.

PTMs for MAT2B Antibody (NBP1-82797)

Learn more about PTMs related to MAT2B Antibody (NBP1-82797).

Research Areas for MAT2B Antibody (NBP1-82797)

Find related products by research area.

Blogs on MAT2B.

MAT2a, MAT2b, HIF-1 alpha: Roles in Liver Cancer and DNA methylation
Methionine Adenosyltransferase II alpha, also known as MAT2a, is a catalytic subunit of methionine adenosyltransferase (MAT) and essential enzyme for the catalysis of the principle biological methyl donor, S-adenosylmethionine (SAM) from methionine an...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Steve Smith
Application: WB
Species: Human


Gene Symbol MAT2B