MAT1A Antibody

Images

 
Western Blot: MAT1A Antibody [NBP1-55120] - MAT1A protein levels are significantly increased in female Cgl null mice with severely elevated plasma tHcy. Western blotting analysis of hepatic GNMT and MAT1A protein ...read more
Immunohistochemistry-Paraffin: MAT1A Antibody [NBP1-55120] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: MAT1A Antibody [NBP1-55120] - WB analysis of MAT1A in mouse liver lysate. Image courtesy of product review submitted by Hua Jiang.
Western Blot: MAT1A Antibody [NBP1-55120] - Antibody Titration: 1. 25 ug/ml Positive control: Jurkat cell lysate.

Product Details

Summary
Reactivity Hu, Mu, Ba, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAT1A Antibody Summary

Immunogen
Synthetic peptides corresponding to MAT1A(methionine adenosyltransferase I, alpha) The peptide sequence was selected from the N terminal of MAT1A (NP_000420). Peptide sequence TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%), Zebrafish (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAT1A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MAT1A and was validated on Western Blot and immunohistochemistry-P. Immunocytochemistry/Immunofluorescence was reported in scientific literature.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-55120 in the following applications:

Publications
Read Publications using
NBP1-55120 in the following applications:

  • 2 publications
  • IHC
    1 publication
  • WB
    3 publications

Reactivity Notes

Bacteria reactivity reported in scientific literature (PMID: 31363118).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAT1A Antibody

  • AdoMet synthase 1
  • adoMet synthetase 1
  • AMS1
  • MAT
  • MATA1MAT 1
  • MAT-I/III
  • Methionine adenosyltransferase 1
  • methionine adenosyltransferase I, alpha
  • Methionine adenosyltransferase I/III
  • S-adenosylmethionine synthase isoform type-1
  • S-adenosylmethionine synthetase isoform type-1
  • SAMS
  • SAMS1EC 2.5.1.6

Background

MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.This gne encodes methionine adenosyltransferase I (alpha isoform), which catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF3989
Species: Hu, Mu, Rt
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF6457
Species: Hu
Applications: WB
NB110-94158
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-73857
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
MAB6526
Species: Hu
Applications: WB, IP
NB100-56530
Species: Hu
Applications: WB
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAT1A Antibody (NBP1-55120)(5)

We have publications tested in 3 confirmed species: Human, Mouse, Bacteria.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(2)
IHC
(1)
WB
(3)
All Applications
Filter By Species
Human
(2)
Mouse
(2)
Bacteria
(1)
All Species

Review for MAT1A Antibody (NBP1-55120) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-55120:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MAT1A NBP1-55120
Enlarge
4
reviewed by:
Anonymous
WB Mouse 07/09/2012
View

Summary

ApplicationWestern Blot
Sample Testedmouse liver
SpeciesMouse
LotQC12080
CommentsOverall, this MAT1A antiboy works fine for our WB. The band of MAT1A is at the right size (Dark arrrow in the fig) and the signal is strong. However, there are two additional non-specific bands around 37 kDa and 25 kDa

Blocking

Blocking Details5% milk in PBS pH 7.4, 0.2% tween 20

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, Alexa Fluor 647
Secondary Manufacturer Cat#A21244
Secondary Concentration1:2500

Details

Detection NotesTyphoon

Comments

CommentsOverall, this MAT1A antiboy works fine for our WB. The band of MAT1A is at the right size (Dark arrrow in the fig) and the signal is strong. However, there are two additional non-specific bands around 37 kDa and 25 kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAT1A Antibody (NBP1-55120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAT1A Products

Bioinformatics Tool for MAT1A Antibody (NBP1-55120)

Discover related pathways, diseases and genes to MAT1A Antibody (NBP1-55120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAT1A Antibody (NBP1-55120)

Discover more about diseases related to MAT1A Antibody (NBP1-55120).
 

Pathways for MAT1A Antibody (NBP1-55120)

View related products by pathway.

PTMs for MAT1A Antibody (NBP1-55120)

Learn more about PTMs related to MAT1A Antibody (NBP1-55120).
 

Research Areas for MAT1A Antibody (NBP1-55120)

Find related products by research area.

Blogs on MAT1A

There are no specific blogs for MAT1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
07/09/2012
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol MAT1A
Entrez
Uniprot