RFC3 Antibody

Images

 
Western Blot: RFC3 Antibody [NBP1-82668] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-473
Immunocytochemistry/ Immunofluorescence: RFC3 Antibody [NBP1-82668] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: RFC3 Antibody [NBP1-82668] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RFC3 Protein (NBP1-82668PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RFC3 Antibody

  • A1 38 kDa subunit
  • Activator 1 38 kDa subunit
  • Activator 1 subunit 3
  • MGC5276
  • replication factor C (activator 1) 3 (38kD)
  • replication factor C (activator 1) 3, 38kDa
  • Replication factor C 38 kDa subunit
  • replication factor C subunit 3
  • RFC, 38 kD subunit
  • RFC38RF-C 38 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56070
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-235
Species: Hu
Applications: WB, PLA
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
409-ML/CF
Species: Mu
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55454
Species: Hu
Applications: WB, ICC/IF
NBP1-82668
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RFC3 Antibody (NBP1-82668) (0)

There are no publications for RFC3 Antibody (NBP1-82668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC3 Antibody (NBP1-82668) (0)

There are no reviews for RFC3 Antibody (NBP1-82668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RFC3 Antibody (NBP1-82668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFC3 Products

Bioinformatics Tool for RFC3 Antibody (NBP1-82668)

Discover related pathways, diseases and genes to RFC3 Antibody (NBP1-82668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC3 Antibody (NBP1-82668)

Discover more about diseases related to RFC3 Antibody (NBP1-82668).
 

Pathways for RFC3 Antibody (NBP1-82668)

View related products by pathway.

PTMs for RFC3 Antibody (NBP1-82668)

Learn more about PTMs related to RFC3 Antibody (NBP1-82668).
 

Research Areas for RFC3 Antibody (NBP1-82668)

Find related products by research area.

Blogs on RFC3

There are no specific blogs for RFC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC3