MAST1 Antibody - BSA Free

Western Blot: MAST1 Antibody [NBP2-85257] - WB Suggested Anti-MAST1 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MAST1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAST1 Antibody - BSA Free (NBP2-85257) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAST1. Peptide sequence: TRDPFPDVVHLEEQDSGGSNTPEQDDLSEGRSSKAKKPPGENDFDTIKLI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAST1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MAST1 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• KIAA0973microtubule-associated serine/threonine-protein kinase 1
• microtubule associated serine/threonine kinase 1
• SAST170
• SASTsyntrophin associated serine/threonine kinase
• Syntrophin-associated serine/threonine-protein kinase

Background

MAST1 (Microtubule Associated Serine/Threonine Kinase 1) has a role in a variety of neural functions. MAST1 is known to have interactions with EGFR, ELAVL3, PTEN, SNTB2, and SNTA1. MAST1 has been studied in relation to rabies, breast cancer, and mastitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAST1