MARK4 Antibody - BSA Free

Western Blot: MARK4 Antibody [NBP2-87777] - Host: Rabbit. Target Name: MARK4. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MARK4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MARK4 Antibody - BSA Free (NBP2-87777) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human MARK4. Peptide sequence: GNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARK4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MARK4 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• FLJ12177
• FLJ90097
• KIAA1860MARK4L
• MAP/microtubule affinity-regulating kinase 4
• MAP/microtubule affinity-regulating kinase like 1
• MAP/microtubule affinity-regulating kinase-like 1
• MARK4 serine/threonine protein kinase
• MARKL1L
• MARKL1MARK4S
• Nbla00650

Background

MARK4 contains an N terminal serine/threonine kinase domain, a central ubiquitin associated domain, and a C terminal KA1 associated kinase domain. RT PCR analysis detects upregulated expression of the gene for MARK4 in nearly all clinical hepatocellular carcinoma cells. Northern blot analysis reveals ubiquitous expression of a 3.6kb transcript, with highest expression in testis. Immunofluorescence microscopy demonstrates homogeneous cytoplasmic expression. Colony forming assays show that MARK4 antisense reduces the growth of SNU475 cells. It has been suggested that MARK4 provides a growth advantage to cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARK4