MARK2 Antibody (3B12)

Images

 
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in NIH/3T3.
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in PC-12.
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in A-431.
ELISA: MARK2 Antibody (3B12) [H00002011-M01] - Detection limit for recombinant GST tagged MARK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MARK2 Antibody (3B12) Summary

Immunogen
MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG
Specificity
MARK2 - MAP/microtubule affinity-regulating kinase 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MARK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:1000
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 29941476).
Control
MARK2 Knockout HeLa Cell Lysate
Publications
Read Publications using
H00002011-M01 in the following applications:

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MARK2 Antibody (3B12)

  • EC 2.7.11
  • EC 2.7.11.1
  • ELKL motif kinase 1
  • ELKL motif kinase
  • EMK-1
  • EMK1PAR-1
  • MAP/microtubule affinity-regulating kinase 2MGC99619
  • PAR1 homolog
  • Par1b
  • Ser/Thr protein kinase PAR-1B
  • serine/threonine protein kinase EMK
  • serine/threonine-protein kinase MARK2

Background

EMK (ELKL Motif Kinase) is a small family of ser/thr protein kinases involved in the control of cell polarity, microtubule stability and cancer. Several cDNA clones have been isolated that encoded two isoforms of the human ser/thr protein kinase EMK1. These isoforms were characterized by the presence of a 162-bp alternative exon that gave rise to two forms, one containing the exon and the other one lacking it. Both forms were found to be coexpressed in a number of selected cell lines and tissue samples. The human EMK1 was shown to be encoded by a single mRNA ubiquitously expressed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
AF2245
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
H00002011-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for MARK2 Antibody (H00002011-M01)(3)

Reviews for MARK2 Antibody (H00002011-M01) (0)

There are no reviews for MARK2 Antibody (H00002011-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MARK2 Antibody (H00002011-M01). (Showing 1 - 1 of 1 FAQs).

  1. I am interested in MARK2 antibody (3B12), and I would like to know how you have verified its specificity. Did you block with antigen peptide? Or, has it been verified in transfected cells, knockout cell, or siRNA cells?
    • The MARK2 antibody was validated in the following cell lysates: PC-12, A-431 and NIH/3T3 as well as validated against recombinant protein/immunogen.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MARK2 Products

Bioinformatics Tool for MARK2 Antibody (H00002011-M01)

Discover related pathways, diseases and genes to MARK2 Antibody (H00002011-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARK2 Antibody (H00002011-M01)

Discover more about diseases related to MARK2 Antibody (H00002011-M01).
 

Pathways for MARK2 Antibody (H00002011-M01)

View related products by pathway.

PTMs for MARK2 Antibody (H00002011-M01)

Learn more about PTMs related to MARK2 Antibody (H00002011-M01).
 

Research Areas for MARK2 Antibody (H00002011-M01)

Find related products by research area.

Blogs on MARK2

There are no specific blogs for MARK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARK2 Antibody (3B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol MARK2
Entrez
OMIM
Uniprot