MARCH9 Antibody - BSA Free

Western Blot: MARCH9 Antibody [NBP2-92035] -analysis of 293T, using MARCH9 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MARCH9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MARCH9 Antibody - BSA Free (NBP2-92035) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 277-346 of human MARCH9 (NP_612405.2). GTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCHF9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MARCH9 Antibody - BSA Free

• E3 ubiquitin-protein ligase MARCH9
• EC 6.3.2.-
• FLJ36578
• MARCH-IX
• membrane-associated ring finger (C3HC4) 9
• Membrane-associated RING finger protein 9
• Membrane-associated RING-CH protein IX
• RNF179RING finger protein 179

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARCHF9