MARCH2 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to MARCH2(membrane-associated ring finger (C3HC4) 2) The peptide sequence was selected form the C terminal of 40239. Peptide sequence TIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSP. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MARCH2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MARCH2 Antibody - BSA Free
Background
MARCH2 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. MARCH2 may be involved in endosomal trafficking through interaction with STX6.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Rt
Applications: IHC, WB
Publications for MARCH2 Antibody (NBP1-59391) (0)
There are no publications for MARCH2 Antibody (NBP1-59391).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MARCH2 Antibody (NBP1-59391) (0)
There are no reviews for MARCH2 Antibody (NBP1-59391).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MARCH2 Antibody (NBP1-59391) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MARCH2 Products
Research Areas for MARCH2 Antibody (NBP1-59391)
Find related products by research area.
|
Blogs on MARCH2