MAPK1IP1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAPK1IP1L Antibody [NBP1-88420] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: MAPK1IP1L Antibody [NBP1-88420] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAPK1IP1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPK1IP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAPK1IP1L Protein (NBP1-88420PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAPK1IP1L Antibody

  • c14_5346
  • C14orf32
  • chromosome 14 open reading frame 32
  • MAPK-interacting and spindle-stabilizing protein
  • MAPK-interacting and spindle-stabilizing protein-like
  • MGC23138
  • MISS
  • mitogen activated protein kinase 1 interacting protein 1-like
  • mitogen-activated protein kinase 1 interacting protein 1-like
  • Mitogen-activated protein kinase 1-interacting protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BPI
7468-BP
Species: Hu
NBP2-16338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA

Publications for MAPK1IP1L Antibody (NBP1-88420) (0)

There are no publications for MAPK1IP1L Antibody (NBP1-88420).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAPK1IP1L Antibody (NBP1-88420) (0)

There are no reviews for MAPK1IP1L Antibody (NBP1-88420). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAPK1IP1L Antibody (NBP1-88420) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAPK1IP1L Products

Bioinformatics Tool for MAPK1IP1L Antibody (NBP1-88420)

Discover related pathways, diseases and genes to MAPK1IP1L Antibody (NBP1-88420). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MAPK1IP1L

There are no specific blogs for MAPK1IP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAPK1IP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK1IP1L