MAMSTR Antibody - BSA Free

Western Blot: MAMSTR Antibody [NBP2-85250] - WB Suggested Anti-FLJ36070 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human heart

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MAMSTR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAMSTR Antibody - BSA Free (NBP2-85250) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human MAMSTR. Peptide sequence: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAMSTR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MAMSTR Antibody - BSA Free

• FLJ36070
• MASTRlikely ortholog of MEF2-activating SAP transcriptional regulator
• MEF2 activating motif and SAP domain containing transcriptional regulator
• MEF2-activating motif and SAP domain-containing transcriptional regulator
• MEF2-activating SAP transcriptional regulator
• MEF2-activating SAP transcriptional regulatory protein
• MGC117259

Background

Transcriptional coactivator. Stimulates the transcriptional activity of MEF2C. Stimulates MYOD1 activity inpart via MEF2, resulting in an enhancement of skeletal muscle differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAMSTR