MALT1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MALT1. Source: E. coli Amino Acid Sequence: KVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MALT1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55513. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MALT1 Recombinant Protein Antigen
Background
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (MALT1), also known as MLT1 or paracaspase 1, is a member of the human paracaspase family and an interacting partner of B-cell lymphoma 10 (Bcl-10) (1). In vitro, In vitro, MALT1 synergizes with BCL10 to enhance nuclear factor B activation (2) and to mediate IB kinase (IKK) activation by facilitating the ubiquitinylation of the NF-B essential modulator (NEMO) (3). MALT1 is found in recurrent chromosomal translocations in non-Hodgkin B-cell lymphoma of the mucosa-associated lymphoid tissue (MALT). One common translocation juxtaposes the MALT1 gene to the IgH promoter region, resulting in up-regulation of Bcl-10 and MALT1 (4). Another common translocation creates a fusion between MALT1 and the inhibitor of apoptosis gene API2 (cIAP2/HIAP1) (5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Publications for MALT1 Recombinant Protein Antigen (NBP2-55513PEP) (0)
There are no publications for MALT1 Recombinant Protein Antigen (NBP2-55513PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MALT1 Recombinant Protein Antigen (NBP2-55513PEP) (0)
There are no reviews for MALT1 Recombinant Protein Antigen (NBP2-55513PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MALT1 Recombinant Protein Antigen (NBP2-55513PEP) (0)
Additional MALT1 Products
Research Areas for MALT1 Recombinant Protein Antigen (NBP2-55513PEP)
Find related products by research area.
|
Blogs on MALT1