MAGP-2/MFAP5 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MAGP-2/MFAP5 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MFAP5.
  
  

  Source: E. coli

  Amino Acid Sequence: GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MFAP5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82803.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAGP-2/MFAP5 Recombinant Protein Antigen

• MAGP2
• MAGP-2
• MAGP2MFAP-5
• MFAP5
• Microfibril-associated glycoprotein 2
• microfibrillar associated protein 5
• microfibrillar-associated protein 5
• MP25
• MP25microfibril-associated glycoprotein-2

Background

MFAP5, also known as Microfibrillar-associated protein 5, is a 173 amino acid protein that is 20 kDa, extracellular matrix secreted, and it is a component of the elastin-associated microfibrils. Current research is being performed on this protein involvement in marfan syndrome, scleroderma and skin fibrosis. The protein is involved in molecules associated with elastic fibres, extracellular matrix organization, elastic fibre formation, tropoelastin associates with microfibrils, elastin cross-linking by lysyl oxidase, and notch signaling pathways where it interacts with FBN2, JAG1, JAG2, MEGF6, VWF, FBLN1, FBN1, GYG1, DLL1, MFAP2, NOTCH1, ENAM, FBN3, and DLL4 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MFAP5