MAGI3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAGI3 Antibody [NBP2-58916] - Staining of human cell line U-2 OS shows localization to cell junctions.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGI3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGI3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAGI3 Antibody

  • dJ730K3.2
  • MAGI-3
  • membrane associated guanylate kinase, WW and PDZ domain containing 3
  • membrane-associated guanylate kinase inverted 3
  • membrane-associated guanylate kinase-related 3
  • WW and PDZ domain-containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF4815
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-2450
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NLS2656
Species: Hu
Applications: ICC, IHC, IHC-P, WB
NBP2-47286
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for MAGI3 Antibody (NBP2-58916) (0)

There are no publications for MAGI3 Antibody (NBP2-58916).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGI3 Antibody (NBP2-58916) (0)

There are no reviews for MAGI3 Antibody (NBP2-58916). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAGI3 Antibody (NBP2-58916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGI3 Products

Bioinformatics Tool for MAGI3 Antibody (NBP2-58916)

Discover related pathways, diseases and genes to MAGI3 Antibody (NBP2-58916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGI3 Antibody (NBP2-58916)

Discover more about diseases related to MAGI3 Antibody (NBP2-58916).
 

Pathways for MAGI3 Antibody (NBP2-58916)

View related products by pathway.

PTMs for MAGI3 Antibody (NBP2-58916)

Learn more about PTMs related to MAGI3 Antibody (NBP2-58916).

Blogs on MAGI3

There are no specific blogs for MAGI3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGI3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGI3