SAGE1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SAGE1 Antibody [NBP1-84354] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: SAGE1 Antibody [NBP1-84354] - Staining of human testis shows strong nuclear positivity in a fraction of cells of seminiferous duct.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAGE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HSVREEKMESGKPQTDKVISNDAPQLGHMAAGGIPSMSTKDLYATVTQNVHEERMENNQPQPSYDLSTVLPGLTYLTVAGIPAMSTRDQYATVTHNVHEEKIKNGQAASDNVFSTVPPAFINMAATGVSSMSTRDQYAAVTHNIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAGE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAGE1 Protein (NBP1-84354PEP)
Publications
Read Publication using
NBP1-84354 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26252478).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAGE1 Antibody

  • putative tumor antigen
  • SAGECT14Cancer/testis antigen 14
  • sarcoma antigen 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-46702
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006757-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP2-07406
Species: Hu
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SAGE1 Antibody (NBP1-84354)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SAGE1 Antibody (NBP1-84354) (0)

There are no reviews for SAGE1 Antibody (NBP1-84354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SAGE1 Antibody (NBP1-84354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAGE1 Products

Bioinformatics Tool for SAGE1 Antibody (NBP1-84354)

Discover related pathways, diseases and genes to SAGE1 Antibody (NBP1-84354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAGE1 Antibody (NBP1-84354)

Discover more about diseases related to SAGE1 Antibody (NBP1-84354).

Blogs on SAGE1

There are no specific blogs for SAGE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAGE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAGE1