![Immunocytochemistry/Immunofluorescence: SAGE1 Antibody [NBP1-84354] - Staining of human cell line U-2 OS shows localization to nucleus.](http://images.novusbio.com/fullsize/SAGE1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84354-img0008.jpg "Immunocytochemistry/Immunofluorescence: SAGE1 Antibody [NBP1-84354] - Staining of human cell line U-2 OS shows localization to nucleus.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SAGE1 Antibody - BSA Free (NBP1-84354) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-SAGE1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HSVREEKMESGKPQTDKVISNDAPQLGHMAAGGIPSMSTKDLYATVTQNVHEERMENNQPQPSYDLSTVLPGLTYLTVAGIPAMSTRDQYATVTHNVHEEKIKNGQAASDNVFSTVPPAFINMAATGVSSMSTRDQYAAVTHNIR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SAGE1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 26252478). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-84354 | Applications | Species |
|---|---|---|
| Maheswaran E, Pedersen CB, Ditzel HJ, Gjerstorff MF. Lack of ADAM2, CALR3 and SAGE1 Cancer/Testis Antigen Expression in Lung and Breast Cancer. PLoS One 2015-01-01 [PMID: 26252478] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SAGE1 |
![Immunohistochemistry-Paraffin: SAGE1 Antibody [NBP1-84354] - Staining in human testis and endometrium tissues using anti-SAGE1 antibody. Corresponding SAGE1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SAGE1-Antibody-Immunohistochemistry-Paraffin-NBP1-84354-img0007.jpg "Immunohistochemistry-Paraffin: SAGE1 Antibody [NBP1-84354] - Staining in human testis and endometrium tissues using anti-SAGE1 antibody. Corresponding SAGE1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SAGE1 Antibody [NBP1-84354] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/SAGE1-Antibody-Immunohistochemistry-Paraffin-NBP1-84354-img0005.jpg "Immunohistochemistry-Paraffin: SAGE1 Antibody [NBP1-84354] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: SAGE1 Antibody [NBP1-84354] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/SAGE1-Antibody-Immunohistochemistry-Paraffin-NBP1-84354-img0006.jpg "Immunohistochemistry-Paraffin: SAGE1 Antibody [NBP1-84354] - Staining of human testis shows high expression.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunohistochemistry SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images2/SLC22A2_MAB6547_Immunohistochemistry_10365.jpg)
![Flow Cytometry SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images2/mab6547_human-slc22a2-oct2-mab-clone-640438-flow-cytometry-169202115433.jpg)
![Multiplex Immunofluorescence SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images/antibody/mab6547_human-slc22a2-oct2-mab-clone-640438-multiplex-immunofluorescence-15112024124421.jpg)
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")