MAGEA4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAGEA4 Antibody [NBP1-84365] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.
Immunohistochemistry-Paraffin: MAGEA4 Antibody [NBP1-84365] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEA4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAGEA4 Protein (NBP1-84365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGEA4 Antibody

  • MAGE-X2 antigen
  • melanoma antigen family A, 4
  • melanoma-associated antigen 4
  • member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45719
Species: Hu
Applications: WB, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-56603
Species: Hu
Applications: WB
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00004111-M01
Species: Hu, Mu
Applications: WB, ELISA
H00002543-T01
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-84365
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MAGEA4 Antibody (NBP1-84365) (0)

There are no publications for MAGEA4 Antibody (NBP1-84365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA4 Antibody (NBP1-84365) (0)

There are no reviews for MAGEA4 Antibody (NBP1-84365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAGEA4 Antibody (NBP1-84365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEA4 Products

Bioinformatics Tool for MAGEA4 Antibody (NBP1-84365)

Discover related pathways, diseases and genes to MAGEA4 Antibody (NBP1-84365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA4 Antibody (NBP1-84365)

Discover more about diseases related to MAGEA4 Antibody (NBP1-84365).
 

Pathways for MAGEA4 Antibody (NBP1-84365)

View related products by pathway.

PTMs for MAGEA4 Antibody (NBP1-84365)

Learn more about PTMs related to MAGEA4 Antibody (NBP1-84365).

Blogs on MAGEA4

There are no specific blogs for MAGEA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA4
Entrez
Uniprot