MAGEA12 Antibody (3A10)

Images

 
Western Blot: MAGEA12 Antibody (3A10) [H00004111-M01] - MAGEA12 monoclonal antibody (M01), clone 3A10. Analysis of MAGEA12 expression in NIH/3T3.
Western Blot: MAGEA12 Antibody (3A10) [H00004111-M01] - MAGEA12 monoclonal antibody (M01), clone 3A10. Analysis of MAGEA12 expression in Raw 264.7.
Western Blot: MAGEA12 Antibody (3A10) [H00004111-M01] - MAGEA12 monoclonal antibody (M01), clone 3A10. Analysis of MAGEA12 expression in Jurkat.
Western Blot: MAGEA12 Antibody (3A10) [H00004111-M01] - MAGEA12 monoclonal antibody (M01), clone 3A10. Analysis of MAGEA12 expression in human liver.
Sandwich ELISA: MAGEA12 Antibody (3A10) [H00004111-M01] - Detection limit for recombinant GST tagged MAGEA12 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
3A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAGEA12 Antibody (3A10) Summary

Immunogen
MAGEA12 (NP_005358, 70 a.a. - 168 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVE
Specificity
MAGEA12 - melanoma antigen family A, 12 (3A10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAGEA12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA12 Antibody (3A10)

  • Cancer/testis antigen 1.12
  • CT1.12MAGE12F antigen
  • MAGE-12 antigen
  • MAGE12cancer/testis antigen family 1, member 12
  • melanoma antigen family A, 12
  • melanoma-associated antigen 12

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-41318
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ICC, IF
NBP2-66278
Species: Hu
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37918
Species: Hu
Applications: IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00266740-P01
Species: Hu
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MAGEA12 Antibody (H00004111-M01) (0)

There are no publications for MAGEA12 Antibody (H00004111-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA12 Antibody (H00004111-M01) (0)

There are no reviews for MAGEA12 Antibody (H00004111-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEA12 Antibody (H00004111-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MAGEA12 Antibody (H00004111-M01)

Discover related pathways, diseases and genes to MAGEA12 Antibody (H00004111-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA12 Antibody (H00004111-M01)

Discover more about diseases related to MAGEA12 Antibody (H00004111-M01).
 

Pathways for MAGEA12 Antibody (H00004111-M01)

View related products by pathway.

PTMs for MAGEA12 Antibody (H00004111-M01)

Learn more about PTMs related to MAGEA12 Antibody (H00004111-M01).

Blogs on MAGEA12

There are no specific blogs for MAGEA12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEA12 Antibody (3A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA12
Entrez
Uniprot