MAD2L1-binding protein Antibody - BSA Free

Western Blot: MAD2L1-binding protein Antibody [NBP1-79887] - Titration: 2 ug/ml Positive Control: A549 lung cancer cells.

Western Blot: MAD2L1-binding protein Antibody [NBP1-79887] - Titration: 1.0 ug/ml Positive Control: MDA-MB-435S Whole Cell.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MAD2L1-binding protein Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence SAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAD2L1BP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MAD2L1-binding protein Antibody - BSA Free

• Caught by MAD2 protein
• CMT2MGC11282
• dJ261G23.1
• KIAA0110RP1-261G23.6
• MAD2L1 binding protein
• MAD2L1-binding protein

Background

MAD2L1-binding protein is encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAD2L1BP
• Uniprot:
  • NP_055443(Human)