Recombinant Human MAD1L1/MAD1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MAD1L1/MAD1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 619-718 of Human MAD1L1/MAD1

Source: Wheat Germ

Amino Acid Sequence: KEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAD1L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAD1L1/MAD1 Protein

  • hMAD1
  • HsMAD1
  • MAD1 mitotic arrest deficient-like 1 (yeast)
  • MAD1
  • MAD1L1
  • MAD1-like protein 1
  • MAD1yeast, homolog-like 1
  • Mitotic checkpoint MAD1 protein homolog
  • PIG9
  • Tax-binding protein 181
  • TP53I9
  • tumor protein p53 inducible protein 9
  • TXBP181
  • TXBP181MAD1 (mitotic arrest deficient, yeast, homolog)-like 1

Background

MAD1L1 - MAD1 mitotic arrest deficient-like 1 (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF4185
Species: Hu
Applications: ICC
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4304
Species: Hu
Applications: WB
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF6028
Species: Hu
Applications: WB, IHC
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1103
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00008379-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01) (0)

There are no publications for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01) (0)

There are no reviews for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01)

Discover related pathways, diseases and genes to MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01)

Discover more about diseases related to MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01).
 

Pathways for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01)

View related products by pathway.

PTMs for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01)

Learn more about PTMs related to MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01).
 

Research Areas for MAD1L1/MAD1 Partial Recombinant Protein (H00008379-Q01)

Find related products by research area.

Blogs on MAD1L1/MAD1

There are no specific blogs for MAD1L1/MAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAD1L1/MAD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAD1L1
Entrez