Mad Antibody (2G10) - Azide and BSA Free

Immunohistochemistry-Paraffin: Mad Antibody (2G10) [H00004084-M03] - Analysis of monoclonal antibody to MXD1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 6 ug/ml

• Reactivity: Hu
• Applications: ELISA, IHC
• Clone: 2G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Mad Antibody (2G10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MXD1 (NP_002348.1, 60 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGST
• Specificity: MXD1 - MAX dimerization protein 1 (2G10)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MXD1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mad Antibody (2G10) - Azide and BSA Free

• antagonizer of myc transcriptional activity
• bHLHc58
• MADMAD1
• MAX dimerization protein 1
• Max dimerizer 1
• MAX-binding protein
• MGC104659
• Protein MAD

Background

MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. This protein competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MXD1
• Entrez:
  • 4084(Human)
• Uniprot:
  • NP_002348(Human)