Mad Antibody (2G10)

Images

 
Immunohistochemistry-Paraffin: Mad Antibody (2G10) [H00004084-M03] - Analysis of monoclonal antibody to MXD1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 6 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC-P
Clone
2G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mad Antibody (2G10) Summary

Immunogen
MXD1 (NP_002348.1, 60 a.a. - 149 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGST
Specificity
MXD1 - MAX dimerization protein 1 (2G10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MXD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mad Antibody (2G10)

  • antagonizer of myc transcriptional activity
  • bHLHc58
  • MADMAD1
  • MAX dimerization protein 1
  • Max dimerizer 1
  • MAX-binding protein
  • MGC104659
  • Protein MAD

Background

MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. This protein competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
AF4185
Species: Hu
Applications: ICC
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-91612
Species: Mu
Applications: WB
AF2097
Species: Hu
Applications: WB, ChIP, ICC
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-04053
Species: Hu
Applications: WB, IP
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
H00004084-M03
Species: Hu
Applications: ELISA, IHC-P

Publications for Mad Antibody (H00004084-M03) (0)

There are no publications for Mad Antibody (H00004084-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mad Antibody (H00004084-M03) (0)

There are no reviews for Mad Antibody (H00004084-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Mad Antibody (H00004084-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mad Products

Bioinformatics Tool for Mad Antibody (H00004084-M03)

Discover related pathways, diseases and genes to Mad Antibody (H00004084-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mad Antibody (H00004084-M03)

Discover more about diseases related to Mad Antibody (H00004084-M03).
 

Pathways for Mad Antibody (H00004084-M03)

View related products by pathway.

PTMs for Mad Antibody (H00004084-M03)

Learn more about PTMs related to Mad Antibody (H00004084-M03).

Blogs on Mad.

The c-Myc Antibody: A Major Tool in Cancer Research
C-Myc is a widely expressed transcription factor, regulating cellular differentiation, proliferation, cell cycle progression and pro-apoptotic gene expression. The c-Myc antibody is widely used in cancer research, as a number of human tumors have been...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mad Antibody (2G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol MXD1
Entrez
Uniprot