M-Ras/R-Ras3 Antibody (3F6Q10) Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 109-208 of human M-Ras/R-Ras3 (O14807).
Sequence: LILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
MRAS |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:100 - 1:500
|
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for M-Ras/R-Ras3 Antibody (3F6Q10)
Background
MRAS (muscle RAS oncogene homolog) belongs to the Ras family of small GTPases and could play a role as a signal transducer. MRAS is known to have interactions with MLLT4, RASSF5, RALGDS, BRAF and PIK3CA. This protein is currently being studied for research on the following diseases and disorders: neuronitis, Parkinson's disease, gigantism and Noonan syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Ca, Ch, Eq, Hu, Mu, Ma-Op, Pm, Xp
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for M-Ras/R-Ras3 Antibody (NBP3-33251) (0)
There are no publications for M-Ras/R-Ras3 Antibody (NBP3-33251).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for M-Ras/R-Ras3 Antibody (NBP3-33251) (0)
There are no reviews for M-Ras/R-Ras3 Antibody (NBP3-33251).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for M-Ras/R-Ras3 Antibody (NBP3-33251) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional M-Ras/R-Ras3 Products
Research Areas for M-Ras/R-Ras3 Antibody (NBP3-33251)
Find related products by research area.
|
Blogs on M-Ras/R-Ras3