M-Ras/R-Ras3 Antibody (3F6Q10)

Western Blot: M-Ras/R-Ras3 Antibody (3F6Q10) [NBP3-33251] - Western blot analysis of various lysates using M-Ras/R-Ras3 Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 3F6Q10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

M-Ras/R-Ras3 Antibody (3F6Q10) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 109-208 of human M-Ras/R-Ras3 (O14807).
  
  Sequence:
  LILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MRAS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:100 - 1:500
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for M-Ras/R-Ras3 Antibody (3F6Q10)

• FLJ42964
• MRas
• M-Ras
• muscle and microspikes RAS
• muscle RAS oncogene homolog
• ras-related protein M-Ras
• Ras-related protein R-Ras3
• R-RAS3
• RRAS3M-RAs

Background

MRAS (muscle RAS oncogene homolog) belongs to the Ras family of small GTPases and could play a role as a signal transducer. MRAS is known to have interactions with MLLT4, RASSF5, RALGDS, BRAF and PIK3CA. This protein is currently being studied for research on the following diseases and disorders: neuronitis, Parkinson's disease, gigantism and Noonan syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRAS