Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

Western Blot: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG

Immunocytochemistry/Immunofluorescence: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883] - Staining of human cell line U-2 OS shows localization to vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free (NBP3-17883) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRCP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - BSA Free

• Angiotensinase C
• EC 3.4.16.2
• HUMPCP
• Lysosomal carboxypeptidase C
• lysosomal Pro-X carboxypeptidase
• PCPMGC2202
• PRCP
• Proline carboxypeptidase
• prolylcarboxypeptidase (angiotensinase C)
• prolylcarboxypeptidase isoform 1 preproprotein
• Prolylcarboxypeptidase

Background

PRCP is encoded by this gene is a lysosomal prolylcarboxypeptidase, which cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRCP