Lyp/PTPN22 Antibody

Images

 
Immunohistochemistry-Paraffin: Lyp/PTPN22 Antibody [NBP1-81276] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lyp/PTPN22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLLNQESAVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQ
Specificity
Specificity of human Lyp/PTPN22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPN22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lyp/PTPN22 Antibody

  • EC 3.1.3.48
  • Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
  • Lymphoid phosphatase
  • lymphoid-specific protein tyrosine phosphatase
  • Lyp
  • Lyp1
  • Lyp2
  • LyPTP
  • PEP
  • PEST-domain phosphatase
  • protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
  • protein tyrosine phosphatase, non-receptor type 8
  • PTPN22
  • PTPN8 (former)
  • PTPN8LYP1
  • tyrosine-protein phosphatase non-receptor type 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-54825
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00051776-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-45312
Species: Hu, Mk, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-P01
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91011
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Lyp/PTPN22 Antibody (NBP1-81276) (0)

There are no publications for Lyp/PTPN22 Antibody (NBP1-81276).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lyp/PTPN22 Antibody (NBP1-81276) (0)

There are no reviews for Lyp/PTPN22 Antibody (NBP1-81276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lyp/PTPN22 Antibody (NBP1-81276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Lyp/PTPN22 Products

Bioinformatics Tool for Lyp/PTPN22 Antibody (NBP1-81276)

Discover related pathways, diseases and genes to Lyp/PTPN22 Antibody (NBP1-81276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lyp/PTPN22 Antibody (NBP1-81276)

Discover more about diseases related to Lyp/PTPN22 Antibody (NBP1-81276).
 

Pathways for Lyp/PTPN22 Antibody (NBP1-81276)

View related products by pathway.

PTMs for Lyp/PTPN22 Antibody (NBP1-81276)

Learn more about PTMs related to Lyp/PTPN22 Antibody (NBP1-81276).
 

Research Areas for Lyp/PTPN22 Antibody (NBP1-81276)

Find related products by research area.

Blogs on Lyp/PTPN22

There are no specific blogs for Lyp/PTPN22, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lyp/PTPN22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN22