Lymphotoxin beta/TNFSF3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lymphotoxin beta/TNFSF3. Peptide sequence: PELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNIS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LTB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Lymphotoxin beta/TNFSF3 Antibody - BSA Free
Background
Tumor necrosis factor (TNF) and lymphotoxin-alpha (LT-alpha, also known as TNF beta) are members of a family of secreted and cell surface cytokines that participate in the regulation of immune and inflammatory responses. LT-beta (lymphotaxin-beta or tumor necrosis factor C) is a type II membrane protein with significant homology to TNF, LT-alpha, and the ligand for the CD40 receptor. LT-alpha is present on the surface of activated T, B, and LAK cells as a complex with the 33 kda glycoprotein, LT-beta. LT-beta, also expressed by active lymphocytes, forms a heterotrimer with LT-a on the cell surface and anchors LT-alpha to the cell surface. A TNF receptor-related protein, the LT-beta receptor (also known as TNFC receptor), is the human receptor for the LT-alpha/LT-beta heterotrimer. There are two LT-beta isoforms expressed in human lymphoid cell lines and non-Hodgkin's lymphomas. The gene which encodes LT-beta maps to the major histocompatibility complex region on human chromosome 6p21.3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for Lymphotoxin beta/TNFSF3 Antibody (NBP2-85244) (0)
There are no publications for Lymphotoxin beta/TNFSF3 Antibody (NBP2-85244).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lymphotoxin beta/TNFSF3 Antibody (NBP2-85244) (0)
There are no reviews for Lymphotoxin beta/TNFSF3 Antibody (NBP2-85244).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lymphotoxin beta/TNFSF3 Antibody (NBP2-85244) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lymphotoxin beta/TNFSF3 Products
Blogs on Lymphotoxin beta/TNFSF3