Recombinant Human Lymphotoxin-alpha/TNF-beta Protein

Product Discontinued

Recombinant Human Lymphotoxin-alpha/TNF-beta Protein Summary

• Description: A partial recombinant protein corresponding to the amino acids 35 - 205 of Human LTA
  
  

  Source: Escherichia coli

  Amino Acid Sequence:LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

• Preparation Method: Escherichia coli expression system
• Details of Functionality: The ED50 was Measured in a cytotoxicity assay using mouse L929 cells in the presence of the metabolic inhibitor actinomycin, and was determined to be less than 0.1 ng/mL.
• Protein/Peptide Type: Recombinant Protein
• Gene: LTA

Applications/Dilutions

• Dilutions:
  • Functional
  • SDS-Page
• Application Notes: This product is useful for SDS-PAGE and Functional assays.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: In PBS, pH 7.5
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lymphotoxin-alpha/TNF-beta Protein

• LT
• LTA
• LT-alpha
• lymphotoxin alpha (TNF superfamily, member 1)
• Lymphotoxin alpha
• Lymphotoxinalpha
• Lymphotoxin-alpha
• tnfb
• TNF-beta
• TNFBlymphotoxin-alpha
• TNFSF1
• TNFSF1B
• TNFSF1TNF-beta
• tumor necrosis factor beta
• Tumor necrosis factor ligand superfamily member 1

Background

TNF-beta (tumor necrosis factor beta, lymphotoxin alpha, TNFSF1, TNF ligand superfamily member 1) a member of the TNF ligand superfamily and a potent lymphoid factor, is mainly produced by activated T and B lymphocytes and leukocytes. TNF-beta is also produced by fibroblasts, astrocytes, myeloma cells, endothelial cells and epithelial cells. TNF-beta mediates inflammatory and immune responses, has cytotoxic activity on tumor cells and other target cells and shares many of the same bioactivities as TNF alpha, including regulation of cell proliferation, differentiation and apoptosis. TNF-beta is not species-specific and human TNF-beta is active on murine cells with a slightly reduced specific activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LTA