Lymphotoxin-alpha/TNF-beta Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LTA. Source: E. coli
Amino Acid Sequence: HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
LTA |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87725. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Lymphotoxin-alpha/TNF-beta Recombinant Protein Antigen
Background
TNF-beta (tumor necrosis factor beta, lymphotoxin alpha, TNFSF1, TNF ligand superfamily member 1) a member of the TNF ligand superfamily and a potent lymphoid factor, is mainly produced by activated T and B lymphocytes and leukocytes. TNF-beta is also produced by fibroblasts, astrocytes, myeloma cells, endothelial cells and epithelial cells. TNF-beta mediates inflammatory and immune responses, has cytotoxic activity on tumor cells and other target cells and shares many of the same bioactivities as TNF alpha, including regulation of cell proliferation, differentiation and apoptosis. TNF-beta is not species-specific and human TNF-beta is active on murine cells with a slightly reduced specific activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Publications for Lymphotoxin-alpha/TNF-beta Protein (NBP1-87725PEP) (0)
There are no publications for Lymphotoxin-alpha/TNF-beta Protein (NBP1-87725PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lymphotoxin-alpha/TNF-beta Protein (NBP1-87725PEP) (0)
There are no reviews for Lymphotoxin-alpha/TNF-beta Protein (NBP1-87725PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Lymphotoxin-alpha/TNF-beta Protein (NBP1-87725PEP) (0)
Additional Lymphotoxin-alpha/TNF-beta Products
Research Areas for Lymphotoxin-alpha/TNF-beta Protein (NBP1-87725PEP)
Find related products by research area.
|
Blogs on Lymphotoxin-alpha/TNF-beta