Lymphotoxin-alpha/TNF-beta Antibody

Images

 
Western Blot: Lymphotoxin-alpha/TNF-beta Antibody [H00004049-D01P] - Analysis of LTA expression in transfected 293T cell line by LTA polyclonal antibody.Lane 1: LTA transfected lysate(22.30 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lymphotoxin-alpha/TNF-beta Antibody Summary

Immunogen
LTA (AAH34729.1, 1 a.a. - 205 a.a.) full-length human protein. MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Specificity
LTA - lymphotoxin alpha (TNF superfamily, member 1),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00004049-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lymphotoxin-alpha/TNF-beta Antibody

  • LT
  • LTA
  • LT-alpha
  • lymphotoxin alpha (TNF superfamily, member 1)
  • Lymphotoxin alpha
  • Lymphotoxinalpha
  • Lymphotoxin-alpha
  • tnfb
  • TNF-beta
  • TNFBlymphotoxin-alpha
  • TNFSF1
  • TNFSF1B
  • TNFSF1TNF-beta
  • tumor necrosis factor beta
  • Tumor necrosis factor ligand superfamily member 1

Background

Lymphotoxin alpha, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. LTA is highly inducible, secreted, and exists as homotrimeric molecule. LTA forms heterotrimers with lymphotoxin-beta which anchors lymphotoxin-alpha to the cell surface. LTA mediates a large variety of inflammatory, immunostimulatory, and antiviral responses. LTA is also involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-56722
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC-P, IP, B/N, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready

Publications for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P)(2)

Reviews for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P) (0)

There are no reviews for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P)

Discover related pathways, diseases and genes to Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P)

Discover more about diseases related to Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P).
 

Pathways for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P)

View related products by pathway.

PTMs for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P)

Learn more about PTMs related to Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P).
 

Research Areas for Lymphotoxin-alpha/TNF-beta Antibody (H00004049-D01P)

Find related products by research area.

Blogs on Lymphotoxin-alpha/TNF-beta

There are no specific blogs for Lymphotoxin-alpha/TNF-beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lymphotoxin-alpha/TNF-beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTA
Entrez
Uniprot