Ly-6E Antibody

Images

 
Western Blot: Ly-6E Antibody [H00004061-D01P] - Analysis of LY6E expression in transfected 293T cell line by LY6E polyclonal antibody.Lane 1: LY6E transfected lysate(13.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ly-6E Antibody Summary

Immunogen
LY6E (NP_002337.1, 1 a.a. - 131 a.a.) full-length human protein. MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
Specificity
Reacts with lymphocyte antigen 6 complex, locus E.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LY6E
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ly-6E Antibody

  • Ly6E
  • Ly-6E
  • lymphocyte antigen 6 complex, locus E
  • Retinoic acid-induced gene E protein
  • RIGE
  • RIGE9804
  • RIG-Ely-6E
  • SCA2
  • SCA2Ly-6E
  • SCA-2lymphocyte antigen 6E
  • Stem cell antigen 2
  • Thymic shared antigen 1
  • TSA1
  • TSA-1retinoic acid induced gene E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF835
Species: Hu, Mu
Applications: ICC
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-44310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-CS
NBP2-49081
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ly-6E Antibody (H00004061-D01P) (0)

There are no publications for Ly-6E Antibody (H00004061-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6E Antibody (H00004061-D01P) (0)

There are no reviews for Ly-6E Antibody (H00004061-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6E Antibody (H00004061-D01P). (Showing 1 - 1 of 1 FAQ).

  1. The following question was asked about Ly-6E Antibody (catalog # H00004061-D01P) (0.1 mg): Can you please tell me what the antibody dilution should be for Ly6E?
    • This antibody is produced by a Taiwanese company called Abnova and we distribute it for them. We have done no in-house testing on it, so the optimal dilutions will have to be user determined. I apologize for the inconvenience.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Ly-6E Antibody (H00004061-D01P)

Discover related pathways, diseases and genes to Ly-6E Antibody (H00004061-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6E Antibody (H00004061-D01P)

Discover more about diseases related to Ly-6E Antibody (H00004061-D01P).
 

Pathways for Ly-6E Antibody (H00004061-D01P)

View related products by pathway.

PTMs for Ly-6E Antibody (H00004061-D01P)

Learn more about PTMs related to Ly-6E Antibody (H00004061-D01P).
 

Research Areas for Ly-6E Antibody (H00004061-D01P)

Find related products by research area.

Blogs on Ly-6E

There are no specific blogs for Ly-6E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ly-6E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6E
Entrez
Uniprot