Ly-6D Antibody

Images

 
Western Blot: Ly-6D Antibody [H00008581-B02P] - Analysis of LY6D expression in A-431.
Western Blot: Ly-6D Antibody [H00008581-B02P] - Analysis of LY6D expression in transfected 293T cell line by LY6D polyclonal antibody. Lane 1: LY6D transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ly-6D Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
LY6D (NP_003686.1, 1 a.a. - 128 a.a.) full-length human protein. MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL
Specificity
LY6D - lymphocyte antigen 6 complex, locus D,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LY6D
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ly-6D Antibody

  • E48E48 antigen
  • Ly-6D
  • lymphocyte antigen 6 complex, locus D
  • lymphocyte antigen 6D

Background

Ly-6D may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ly-6D Antibody (H00008581-B02P) (0)

There are no publications for Ly-6D Antibody (H00008581-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6D Antibody (H00008581-B02P) (0)

There are no reviews for Ly-6D Antibody (H00008581-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6D Antibody (H00008581-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ly-6D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6D
Entrez
Uniprot