Home » Ly-6D » Ly-6D Antibodies » Ly-6D Antibody

Ly-6D Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Ly-6D Antibody [H00008581-B02P] - Analysis of LY6D expression in A-431.
Western Blot: Ly-6D Antibody [H00008581-B02P] - Analysis of LY6D expression in A-431.
Western Blot: Ly-6D Antibody [H00008581-B02P] - Analysis of LY6D expression in transfected 293T cell line by LY6D polyclonal antibody. Lane 1: LY6D transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Ly-6D Antibody Summary

Immunogen
LY6D (NP_003686.1, 1 a.a. - 128 a.a.) full-length human protein. MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL
Specificity
LY6D - lymphocyte antigen 6 complex, locus D,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LY6D
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ly-6D Antibody

  • E48E48 antigen
  • Ly-6D
  • lymphocyte antigen 6 complex, locus D
  • lymphocyte antigen 6D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ly-6E Antibody
NBP1-52176
Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP1-52176] - Immunofluorescence analysis of paraformaldehyde fixed NIH3T3 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP1-52176] - Immunofluorescence analysis of paraformaldehyde fixed L929 cells (Mouse fibroblast cell line), permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: Ly-6E Antibody [NBP1-52176] - Flow cytometric analysis of paraformaldehyde fixed NIH3T3 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(12 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
ACOX1 Antibody
NBP1-80950
Immunocytochemistry/Immunofluorescence: ACOX1 Antibody [NBP1-80950] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human gastrointestinal, kidney, liver and pancreas using Anti-ACOX1 antibody NBP1-80950 (A) shows similar protein distribution across tissues to independent antibody NBP1-80949 (B).
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Thymosin beta 4
Antibody [Unconjugate
AF6796
Western blot shows lysates of human peripheral blood lymphocytes (PBL), HL‑60 human acute promyelocytic leukemia cell line, and human mature dendritic cells. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human Thymosin  beta 4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6796) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Thymosin  beta 4 at approximately 5 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Thymosin  beta 4 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Sheep Anti-Human Thymosin  beta 4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6796) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, Simple Western, WB
Coagulation Factor
X Antibody
NBP1-33320
Western Blot: Coagulation Factor X Antibody [NBP1-33320] - HepG2 whole cell extract and conditioned medium (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Factor X antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunocytochemistry/Immunofluorescence: Coagulation Factor X Antibody [NBP1-33320] - Methanol-fixed HeLa, using Factor X antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Coagulation Factor X Antibody [NBP1-33320] - NCI-N87 xenograft, using Factor X antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TSTA3 Antibody
NBP1-59130
Western Blot: TSTA3 Antibody [NBP1-59130] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Immunocytochemistry/Immunofluorescence: TSTA3 Antibody [NBP1-59130] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution P
Western Blot: TSTA3 Antibody [NBP1-59130] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml TSTA3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TCF-3/E2A Antibody
(826927)
MAB7650
Western blot shows lysates of D3 mouse embryonic stem cell line and P19 mouse embryonal carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Rat Anti-Mouse TCF‑3/E2A Monoclonal Antibody (Catalog # MAB7650) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for TCF‑3/E2A at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TCF‑3/E2A was detected in immersion fixed frozen sections of E9.5 mouse embryo using Rat Anti-Mouse TCF‑3/E2A Monoclonal Antibody (Catalog # MAB7650) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to branchial arch nuclei. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Publications)
Species: Mu
Applications: IHC, WB
EBF-1 Antibody
(1G8)
H00001879-M02
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 expression in transfected 293T cell line by EBF1 monoclonal antibody (M02), clone 1G8.Lane 1: EBF1 transfected lysate(64 KDa).Lane 2: Non-transfected lysate.
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 over-expressed 293 cell line, cotransfected with EBF1 Validated Chimera RNAi ( Cat # H00001879-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EBF1 monoclonal antibody (M02), clone 1G8 (Cat # H00001879-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: EBF-1 Antibody (1G8) [H00001879-M02] - Detection limit for recombinant GST tagged EBF1 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ELISA, IP, KD, S-ELISA, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
E-Selectin/CD62E
Antibody (BBIG-E4) [U ...
BBA16
E‑Selectin/CD62E was detected in immersion fixed paraffin-embedded sections of human brain (occipital cortex) using 10 µg/mL Mouse Anti-Human E‑Selectin/CD62E Monoclonal Antibody (Catalog # BBA16) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
E-Selectin/CD62E was detected in immersion fixed HUVEC human umbilical vein endothelial cells activated with TNF‑ alpha (Catalog # 210-TA-010) using Mouse Anti-Human E‑Selectin/CD62E Monoclonal Antibody (Catalog # BBA16) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(39 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Rit1 Antibody
(456201)
MAB4697
Western blot shows lysates of human brain tissue and HUVEC human umbilical vein endothelial cells. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human Rit1 Monoclonal Antibody (Catalog # MAB4697) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Rit1 at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Species: Hu
Applications: WB
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of CRC cells with Cytokeratin 20 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded human colon cancer tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
POU2F3 Antibody
NBP1-83966
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skin shows moderate to strong nuclear positivity in keratinocytes.
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Staining of human skeletal muscle shows no positivity in myocytes
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966] - Analysis in human skin and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(10 Reviews)
(48 Publications)
Species: Hu
Applications: BA
Pax5/BSAP Antibody
NBP2-38790
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Analysis in human lymph node and cerebral cortex tissues. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human cerebral cortex shows no positivity in neurons as expected.
(1 Review)
(3 Publications)
Species: Ha, Hu, Rt
Applications: IHC, IHC-P
SS18L1 Antibody
NBP2-20486
Immunoprecipitation: SS18L1 Antibody [NBP2-20486] - Immunoprecipitation of CREST protein from MCF-7 whole cell extracts using 5 ug of CREST antibody [N1C2] . Western blot analysis was performed using CREST antibody [N1C2]. EasyBlot anti-Rabbit IgG was used as a secondary reagent.
Immunohistochemistry-Paraffin: SS18L1 Antibody [NBP2-20486] - Immunohistochemical analysis of paraffin-embedded Huh-7 xenograft, using antibody at 1:500 dilution.
Immunocytochemistry/Immunofluorescence: SS18L1 Antibody [NBP2-20486] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(15 Publications)
Species: Hu
Applications: ELISA
CD36 Antibody -
BSA Free
NB400-144
Western Blot: CD36 Antibody [NB400-144] - Mouse primary muscle cell lysate. Western blot image submitted by a verified customer review.
Immunohistochemistry: CD36 Antibody [NB400-144] - Timp4-deficiency results in defective lipid digestion and absorption. (B) Immunostaining for CD36 in small intestine (proximal region) of chow-fed and HFD-fed WT and Timp4-/- mice. Western blot (C) and mRNA (D) for CD36 in enterocyte fraction of chow-fed and HFD-fed WT and Timp4-/- mice (collected from the proximal small intestine). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-05951-4), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: CD36 Antibody [NB400-144] - Bone marrrow derived mouse macrophages stained with CD36 antibody. ICC/IF image submitted by a verified customer review.
(9 Reviews)
(94 Publications)
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Ly-6D Antibody
H00008581-B02P
Ly-6D Antibody
Species: Hu
Applications: WB

Publications for Ly-6D Antibody (H00008581-B02P) (0)

There are no publications for Ly-6D Antibody (H00008581-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6D Antibody (H00008581-B02P) (0)

There are no reviews for Ly-6D Antibody (H00008581-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6D Antibody (H00008581-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ly-6D Products

Bioinformatics Tool for Ly-6D Antibody (H00008581-B02P)

Discover related pathways, diseases and genes to Ly-6D Antibody (H00008581-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6D Antibody (H00008581-B02P)

Discover more about diseases related to Ly-6D Antibody (H00008581-B02P).
 

Pathways for Ly-6D Antibody (H00008581-B02P)

View related products by pathway.

PTMs for Ly-6D Antibody (H00008581-B02P)

Learn more about PTMs related to Ly-6D Antibody (H00008581-B02P).

Blogs on Ly-6D

There are no specific blogs for Ly-6D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ly-6D Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LY6D
Entrez
Uniprot