Recombinant Human LSS Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LSS Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 633-732 of Human LSS

Source: Wheat Germ

Amino Acid Sequence: FESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LSS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LSS Protein

  • EC 5.4.99.7
  • FLJ350152,3-epoxysqualene--lanosterol cyclase
  • FLJ39450
  • FLJ46393
  • hOSC
  • human lanosterol synthase, EC 5.4.99.710EC 5.4.99
  • lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)2,3-epoxysqualene-lanosterol cyclase
  • lanosterol synthase
  • OSCFLJ25486
  • Oxidosqualene--lanosterol cyclase

Background

The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83164
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79794
Species: Hu
Applications: WB, IHC, IP
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7940
Species: Hu
Applications: WB, IHC
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for LSS Partial Recombinant Protein (H00004047-Q01) (0)

There are no publications for LSS Partial Recombinant Protein (H00004047-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSS Partial Recombinant Protein (H00004047-Q01) (0)

There are no reviews for LSS Partial Recombinant Protein (H00004047-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSS Partial Recombinant Protein (H00004047-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LSS Products

Bioinformatics Tool for LSS Partial Recombinant Protein (H00004047-Q01)

Discover related pathways, diseases and genes to LSS Partial Recombinant Protein (H00004047-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSS Partial Recombinant Protein (H00004047-Q01)

Discover more about diseases related to LSS Partial Recombinant Protein (H00004047-Q01).
 

Pathways for LSS Partial Recombinant Protein (H00004047-Q01)

View related products by pathway.

PTMs for LSS Partial Recombinant Protein (H00004047-Q01)

Learn more about PTMs related to LSS Partial Recombinant Protein (H00004047-Q01).

Blogs on LSS

There are no specific blogs for LSS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LSS Antibody
NBP1-82474

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LSS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LSS