![Western Blot: LSM14B Antibody [NBP2-56828] - Western blot analysis in control (vector only transfected HEK293T lysate) and LSM14B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/LSM14B-Antibody-Western-Blot-NBP2-56828-img0003.jpg "Western Blot: LSM14B Antibody [NBP2-56828] - Western blot analysis in control (vector only transfected HEK293T lysate) and LSM14B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit LSM14B Antibody - BSA Free (NBP2-56828) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK |
| Predicted Species | Mouse (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LSM14B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
| Publications using NBP2-56828 | Applications | Species |
|---|---|---|
| Wan Y, Yang S, Li T et al. LSM14B is essential for mitochondrial clustering in the oocyte meiosis bioRxiv 2023-04-28 (IF, WB, Mouse) Details: 1:1000 dilution WB, 1:400 dilution IF |
IF, WB | Mouse |
| Fan H, Liu R, Yu R et al. The E3 ubiquitin ligase adaptor KLHL8 targets ZAR1 to regulate maternal mRNA degradation in oocytes. EMBO Reports 2025-07-28 [PMID: 40721554] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LSM14B |
![Immunocytochemistry/Immunofluorescence: LSM14B Antibody [NBP2-56828] - Staining of human cell line SiHa shows localization to vesicles.](http://images.novusbio.com/fullsize/LSM14B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56828-img0001.jpg "Immunocytochemistry/Immunofluorescence: LSM14B Antibody [NBP2-56828] - Staining of human cell line SiHa shows localization to vesicles.")
![Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human endometrium shows weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LSM14B-Antibody-Immunohistochemistry-Paraffin-NBP2-56828-img0007.jpg "Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human endometrium shows weak cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/LSM14B-Antibody-Immunohistochemistry-Paraffin-NBP2-56828-img0005.jpg "Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/LSM14B-Antibody-Immunohistochemistry-Paraffin-NBP2-56828-img0006.jpg "Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/LSM14B-Antibody-Immunohistochemistry-Paraffin-NBP2-56828-img0008.jpg "Immunohistochemistry-Paraffin: LSM14B Antibody [NBP2-56828] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")