LRRC41 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRC41 Antibody [NBP2-14200] - Staining of human cell line PC-3 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: LRRC41 Antibody [NBP2-14200] - Staining of human tonsil shows cytoplasmic positivity in germinal and non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEV ACGALDGSDPSCLGLPALEASQRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC41
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC41 Protein (NBP2-14200PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC41 Antibody

  • leucine rich repeat containing 41
  • leucine-rich repeat-containing protein 41
  • MGC126571
  • MGC126573
  • MUF1 protein (MUF1)
  • MUF1elongin BC-interacting leucine-rich repeat protein
  • Protein Muf1
  • RP4-636H5.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22970
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15353
Species: Hu
NBP1-87544
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
NB500-168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
46770002
Species: Hu
Applications: ELISA
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA

Publications for LRRC41 Antibody (NBP2-14200) (0)

There are no publications for LRRC41 Antibody (NBP2-14200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC41 Antibody (NBP2-14200) (0)

There are no reviews for LRRC41 Antibody (NBP2-14200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC41 Antibody (NBP2-14200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC41 Products

Bioinformatics Tool for LRRC41 Antibody (NBP2-14200)

Discover related pathways, diseases and genes to LRRC41 Antibody (NBP2-14200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC41 Antibody (NBP2-14200)

Discover more about diseases related to LRRC41 Antibody (NBP2-14200).
 

Pathways for LRRC41 Antibody (NBP2-14200)

View related products by pathway.

Blogs on LRRC41

There are no specific blogs for LRRC41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC41