LRRC41 Antibody


Immunocytochemistry/ Immunofluorescence: LRRC41 Antibody [NBP2-14200] - Staining of human cell line PC-3 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: LRRC41 Antibody [NBP2-14200] - Staining of human tonsil shows cytoplasmic positivity in germinal and non-germinal center cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

LRRC41 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIVAGEKEDGEEMEIGEV ACGALDGSDPSCLGLPALEASQRF
Specificity of human LRRC41 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC41 Protein (NBP2-14200PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LRRC41 Antibody

  • leucine rich repeat containing 41
  • leucine-rich repeat-containing protein 41
  • MGC126571
  • MGC126573
  • MUF1 protein (MUF1)
  • MUF1elongin BC-interacting leucine-rich repeat protein
  • Protein Muf1
  • RP4-636H5.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow

Publications for LRRC41 Antibody (NBP2-14200) (0)

There are no publications for LRRC41 Antibody (NBP2-14200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC41 Antibody (NBP2-14200) (0)

There are no reviews for LRRC41 Antibody (NBP2-14200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC41 Antibody (NBP2-14200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LRRC41 Products

Bioinformatics Tool for LRRC41 Antibody (NBP2-14200)

Discover related pathways, diseases and genes to LRRC41 Antibody (NBP2-14200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC41 Antibody (NBP2-14200)

Discover more about diseases related to LRRC41 Antibody (NBP2-14200).

Pathways for LRRC41 Antibody (NBP2-14200)

View related products by pathway.

Blogs on LRRC41

There are no specific blogs for LRRC41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRRC41 Antibody and receive a gift card or discount.


Gene Symbol LRRC41