LRRC32/GARP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Staining of human cell line U-2197 shows localization to vesicles and nucleus. Antibody staining is shown in green.

Immunocytochemistry/ Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Immunofluorescent staining experiment.For immunofluorescent staining experiment, we used GARP antibody to show the expression of GARP protein, homologous anti-IgG antibody as isotype control & DAPI to show the location of nucleus. GARP, Glycoprotein A repetitions predominant; DAPI, diamidino-phenyl-indole. (A) & (D) showed the merge image of two groups; (B) & (E) showed the FITC immunofluorescent staining; (C) & (F) showed the DAPI staining; 200X; Bar = 50 µm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31198639), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Rt, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRRC32/GARP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LRRC32/GARP Antibody - BSA Free (NBP2-68740) is a polyclonal antibody validated for use in ICC/IF. Anti-LRRC32/GARP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC32
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31198639).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LRRC32/GARP Antibody - BSA Free

• D11S833E
• D11S833Eleucine-rich repeat-containing protein 32
• GARP
• GARPGarpin
• Garpin
• Glycoprotein A repetitions predominantgarpin
• leucine rich repeat containing 32
• LRRC32

Background

LRRC32 encodes a type I membrane protein which contains 20 leucine-rich repeats. Alterations in the chromosomal region 11q13-11q14 are involved in several pathologies. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRC32/GARP Antibody (NBP2-68740)(1)

Publication using NBP2-68740

• Li R, Sun J, Yang F et al. Effect of GARP on osteogenic differentiation of bone marrow mesenchymal stem cells via the regulation of TGF beta 1 in vitro PeerJ 2019-05-23 [PMID: 31198639] (ICC/IF, Rat)

Bioinformatics

• Gene Symbol: LRRC32