![Immunocytochemistry/Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Staining of human cell line U-2197 shows localization to vesicles and nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LRRC32-GARP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-68740-img0002.jpg "Immunocytochemistry/Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Staining of human cell line U-2197 shows localization to vesicles and nucleus. Antibody staining is shown in green.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LRRC32 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | ICC/IF, Fixation/Permeabilization: PFA/Triton X-100 |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Flow Cytometry L-Selectin/CD62L Antibody (4G8) [Unconjugated]](https://images.novusbio.com/images/antibody/bba24_human-l-selectin-cd62l-mab-cl-4g8-flow-cytometry-822024174319..jpg)
![Western Blot PD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PD1_AF1086_Western_Blot_20838.jpg)
![Immunohistochemistry PD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PD1_AF1086_Immunohistochemistry_17216.jpg)
![Western Blot PD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PD1_AF1086_Western_Blot_19120.jpg)
| Publication using NBP2-68740 | Applications | Species |
|---|---|---|
| Li R, Sun J, Yang F et al. Effect of GARP on osteogenic differentiation of bone marrow mesenchymal stem cells via the regulation of TGF beta 1 in vitro PeerJ 2019-05-23 [PMID: 31198639] (ICC/IF, Rat) | ICC/IF | Rat |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LRRC32 |
![Immunocytochemistry/ Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Immunofluorescent staining experiment.For immunofluorescent staining experiment, we used GARP antibody to show the expression of GARP protein, homologous anti-IgG antibody as isotype control & DAPI to show the location of nucleus. GARP, Glycoprotein A repetitions predominant; DAPI, diamidino-phenyl-indole. (A) & (D) showed the merge image of two groups; (B) & (E) showed the FITC immunofluorescent staining; (C) & (F) showed the DAPI staining; 200X; Bar = 50 µm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31198639), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-68740_rabbit-polyclonal-lrrc32-garp-antibody-310202415384134.jpg "Immunocytochemistry/ Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Immunofluorescent staining experiment.For immunofluorescent staining experiment, we used GARP antibody to show the expression of GARP protein, homologous anti-IgG antibody as isotype control & DAPI to show the location of nucleus. GARP, Glycoprotein A repetitions predominant; DAPI, diamidino-phenyl-indole. (A) & (D) showed the merge image of two groups; (B) & (E) showed the FITC immunofluorescent staining; (C) & (F) showed the DAPI staining; 200X; Bar = 50 µm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31198639), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/IL-2_R_alpha_DR2A00_ELISA_167.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/DATA_CD25_DR2A00_ELISA_800.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")