LRRC15 Antibody - BSA Free

Western Blot: LRRC15 Antibody [NBP1-91365] - Host: Rabbit. Target: LRRC15. Positive control (+): Human Lung (LU). Negative control (-): Human Fetal Heart (HE). Antibody concentration: 3ug/ml

Western Blot: LRRC15 Antibody [NBP1-91365] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: LRRC15 Antibody [NBP1-91365] - Host: Rabbit. Target Name: LRRC15. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 2ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LRRC15 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human LRRC15 (NP_570843). Peptide sequence LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LRRC15 Antibody - BSA Free

• hLib
• leucine rich repeat containing 15
• LIB
• LRRC15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRC15
• Entrez:
  • 131578(Human)
• Uniprot:
  • Q8TF66()