LRP-6 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related LRP-6 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-86345PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LRP-6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRP6.

Source: E. coli

Amino Acid Sequence: GALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LRP6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86345.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LRP-6 Recombinant Protein Antigen

  • ADCAD2
  • FLJ90062
  • FLJ90421
  • low density lipoprotein receptor-related protein 6
  • low-density lipoprotein receptor-related protein 6
  • LRP6
  • LRP-6

Background

Please note, this product is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot (see Application Notes below). However no additional claims are made for their ability to recognise native protein in any application. LRP6 is essential for the Wnt/beta catenin signaling pathway, probably by acting as a coreceptor together with Frizzled for Wnt. It is a specific, high-affinity receptor for DKK1 and DKK2, but not DKK3. The interaction with DKK1 blocks LRP6-mediated Wnt/beta catenin signaling via LRP6 removal via Kremen proteins-mediated endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7344-LR
Species: Mu
Applications: BA
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
5439-DK
Species: Hu
Applications: BA
AF3287
Species: Hu, Mu, Rt
Applications: WB
5036-WN
Species: Hu
Applications: BA, BA
AF1120
Species: Mu
Applications: IHC, WB
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-46367
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1617
Species: Hu
Applications: WB
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP1-89679
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1647
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB

Publications for LRP-6 Protein (NBP1-86345PEP) (0)

There are no publications for LRP-6 Protein (NBP1-86345PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP-6 Protein (NBP1-86345PEP) (0)

There are no reviews for LRP-6 Protein (NBP1-86345PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LRP-6 Protein (NBP1-86345PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRP-6 Products

Research Areas for LRP-6 Protein (NBP1-86345PEP)

Find related products by research area.

Blogs on LRP-6

There are no specific blogs for LRP-6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LRP-6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP6