LRP-6 Antibody

Immunohistochemistry-Paraffin: LRP-6 Antibody [NBP1-86345] - Staining in human kidney and lymph node tissues using anti-LRP6 antibody. Corresponding LRP6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LRP-6 Antibody [NBP1-86345] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: LRP-6 Antibody [NBP1-86345] - Staining of human kidney shows high expression.

Product Discontinued

LRP-6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQ
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRP6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRP-6 Antibody

• ADCAD2
• FLJ90062
• FLJ90421
• low density lipoprotein receptor-related protein 6
• low-density lipoprotein receptor-related protein 6
• LRP6
• LRP-6

Background

Please note, this product is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot (see Application Notes below). However no additional claims are made for their ability to recognise native protein in any application. LRP6 is essential for the Wnt/beta catenin signaling pathway, probably by acting as a coreceptor together with Frizzled for Wnt. It is a specific, high-affinity receptor for DKK1 and DKK2, but not DKK3. The interaction with DKK1 blocks LRP6-mediated Wnt/beta catenin signaling via LRP6 removal via Kremen proteins-mediated endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRP6