LRP-6 Antibody

Images

 
Immunohistochemistry: LRP-6 Antibody [NBP1-86345] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells of tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRP-6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRP-6 Protein (NBP1-86345PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRP-6 Antibody

  • ADCAD2
  • FLJ90062
  • FLJ90421
  • low density lipoprotein receptor-related protein 6
  • low-density lipoprotein receptor-related protein 6
  • LRP6
  • LRP-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF1120
Species: Mu
Applications: WB, IHC
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-46367
Species: Hu
Applications: WB, IHC
AF1617
Species: Hu
Applications: WB
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF1620
Species: Mu
Applications: WB, IHC
AF1647
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA

Publications for LRP-6 Antibody (NBP1-86345) (0)

There are no publications for LRP-6 Antibody (NBP1-86345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP-6 Antibody (NBP1-86345) (0)

There are no reviews for LRP-6 Antibody (NBP1-86345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRP-6 Antibody (NBP1-86345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRP-6 Products

Bioinformatics Tool for LRP-6 Antibody (NBP1-86345)

Discover related pathways, diseases and genes to LRP-6 Antibody (NBP1-86345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP-6 Antibody (NBP1-86345)

Discover more about diseases related to LRP-6 Antibody (NBP1-86345).
 

Pathways for LRP-6 Antibody (NBP1-86345)

View related products by pathway.

PTMs for LRP-6 Antibody (NBP1-86345)

Learn more about PTMs related to LRP-6 Antibody (NBP1-86345).
 

Research Areas for LRP-6 Antibody (NBP1-86345)

Find related products by research area.

Blogs on LRP-6

There are no specific blogs for LRP-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRP-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP6
Entrez