LRP-1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRP-1B Antibody [NBP2-76566] - Staining of human cell line HEK 293 shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRP-1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRP1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87)%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LRP-1B Antibody

  • EC 1.1.1.94
  • EC 3.4.21.9
  • low density lipoprotein receptor related protein-deleted in tumor
  • low density lipoprotein receptor-related protein 1B
  • low density lipoprotein-related protein 1B (deleted in tumors)
  • Low-density lipoprotein receptor-related protein-deleted in tumor
  • LRP1B
  • LRP-1B
  • LRP-deleted in tumors
  • LRPDIT
  • LRP-DIT
  • LRP-DITlow-density lipoprotein receptor-related protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64808
Species: Hu, Mu
Applications: ELISA, Flow, IF, IHC, IHC-Fr, IP, WB
NBP1-33560
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-89683
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00010438-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB5699
Species: Hu
Applications: IHC
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
NBP1-89062
Species: Hu
Applications: IHC, IHC-P, WB
MAB5948
Species: Hu
Applications: Flow, IHC, WB
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-2216
Species: Ch, Hu, Mu
Applications: ICC/IF, PAGE, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-78162
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DUP00
Species: Hu
Applications: ELISA
1310-SE
Species: Hu
Applications: EnzAct
NBP2-76566
Species: Hu
Applications: ICC/IF

Publications for LRP-1B Antibody (NBP2-76566) (0)

There are no publications for LRP-1B Antibody (NBP2-76566).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP-1B Antibody (NBP2-76566) (0)

There are no reviews for LRP-1B Antibody (NBP2-76566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRP-1B Antibody (NBP2-76566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRP-1B Products

Bioinformatics Tool for LRP-1B Antibody (NBP2-76566)

Discover related pathways, diseases and genes to LRP-1B Antibody (NBP2-76566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP-1B Antibody (NBP2-76566)

Discover more about diseases related to LRP-1B Antibody (NBP2-76566).
 

Pathways for LRP-1B Antibody (NBP2-76566)

View related products by pathway.

PTMs for LRP-1B Antibody (NBP2-76566)

Learn more about PTMs related to LRP-1B Antibody (NBP2-76566).
 

Research Areas for LRP-1B Antibody (NBP2-76566)

Find related products by research area.

Blogs on LRP-1B

There are no specific blogs for LRP-1B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRP-1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP1B