Home » LRP-1B » LRP-1B Antibodies » LRP-1B Antibody

LRP-1B Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: LRP-1B Antibody [NBP2-76566] - Staining of human cell line HEK 293 shows localization to vesicles. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: LRP-1B Antibody [NBP2-76566] - Staining of human cell line HEK 293 shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LRP-1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRP1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87)%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LRP-1B Antibody

  • EC 1.1.1.94
  • EC 3.4.21.9
  • low density lipoprotein receptor related protein-deleted in tumor
  • low density lipoprotein receptor-related protein 1B
  • low density lipoprotein-related protein 1B (deleted in tumors)
  • Low-density lipoprotein receptor-related protein-deleted in tumor
  • LRP1B
  • LRP-1B
  • LRP-deleted in tumors
  • LRPDIT
  • LRP-DIT
  • LRP-DITlow-density lipoprotein receptor-related protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LRP-1 Antibody
(A2Mr alpha-2) - BSA ...
NB100-64808
Immunohistochemistry: LRP-1 Antibody (A2Mr alpha-2) [NB100-64808] - Immunoperoxidase staining of a human tonsil cryosection with Mouse anti Human CD91 antibody, clone A2Mr alpha-2 followed by the Histar detection system. Low power.
Immunohistochemistry: LRP-1 Antibody (A2Mr alpha-2) [NB100-64808] - Immunoperoxidase staining of a human tonsil cryosection with Mouse anti Human CD91 antibody, clone A2Mr alpha-2 followed by the Histar detection system. Medium power.
Immunohistochemistry: LRP-1 Antibody (A2Mr alpha-2) [NB100-64808] - Immunoperoxidase staining of a human tonsil cryosection with Mouse anti Human CD91 antibody, clone A2Mr alpha-2 followed by the Histar detection system. Medium power.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, IF, IHC, IHC-Fr, IP, WB
MVP Antibody
NBP1-33560
Immunocytochemistry/Immunofluorescence: MVP Antibody [NBP1-33560] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: MVP Antibody [NBP1-33560] - A549 xenograft, using LRP(MVP) antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: MVP Antibody [NBP1-33560] - Sample (30 ug of whole cell lysate) A: Molt-4 7.5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
RPSA Antibody
(RPSA/2699) - Azide a ...
NBP2-79854
Immunohistochemistry-Paraffin: RPSA Antibody (RPSA/2699) - Azide and BSA Free [NBP2-79854] - Formalin-fixed, paraffin-embedded human Colon Carcinoma stained with RPSA Antibody (RPSA/2699).
Immunohistochemistry-Paraffin: RPSA Antibody (RPSA/2699) - Azide and BSA Free [NBP2-79854] - Formalin-fixed, paraffin-embedded human Breast Carcinoma stained with RPSA Antibody (RPSA/2699).
Immunohistochemistry-Paraffin: RPSA Antibody (RPSA/2699) - Azide and BSA Free [NBP2-79854] - Formalin-fixed, paraffin-embedded human Basal Cell Carcinoma stained with RPSA Antibody (RPSA/2699).
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
PTP alpha/PTPRA
Antibody
NBP1-89683
Western Blot: PTP alpha/PTPRA Antibody [NBP1-89683] - Analysis in control (vector only transfected HEK293T lysate) and PTPRA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry: PTP alpha/PTPRA Antibody [NBP1-89683] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Environmental novelty exacerbates stress hormones and Aβ pathology in an Alzheimer's model. Sci Rep (2017)
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(48 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
C1D Antibody (6H2)
H00010438-M03
ELISA: C1D Antibody (6H2) [H00010438-M03] - Detection limit for recombinant GST tagged C1D is approximately 0.1ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: C1D Antibody (6H2) [H00010438-M03] - Analysis of monoclonal antibody to C1D on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: C1D Antibody (6H2) [H00010438-M03] - Analysis of monoclonal antibody to C1D on formalin-fixed paraffin-embedded human colon. Antibody concentration 1 ug/ml
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SorLA Antibody
(525122)
MAB5699
SorLA was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Mouse Anti-Human SorLA Monoclonal Antibody (Catalog # MAB5699) at 25 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP‑DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific labeling was localized to the cytoplasmic granules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
SorLA was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Mouse Anti-Human SorLA Monoclonal Antibody (Catalog # MAB5699) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: IHC
LDLR Antibody (C7)
NBP1-78159
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Antibody was tested in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
(1 Review)
(20 Publications)
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
FHIT Antibody
NBP1-89062
Western Blot: FHIT Antibody [NBP1-89062] - Analysis in control (vector only transfected HEK293T lysate) and fHIT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human colon, kidney, lymph node and testis using Anti-FHIT antibody NBP1-89062 (A) shows similar protein distribution across tissues to independent antibody NBP1-89061 (B).
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human lymph node.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
LRP-4 Antibody
(741704) [Unconjugate
MAB5948
LRP‑4 was detected in immersion fixed paraffin-embedded sections of human brain (medulla) using Mouse Anti-Human LRP‑4 Monoclonal Antibody (Catalog # MAB5948) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm of neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of rat embryonic cortical glial cells and human brain (cortex) tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human LRP‑4 Monoclonal Antibody (Catalog # MAB5948) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for LRP‑4 at approximately 220 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
U-2 OS human osteosarcoma cell line was stained with Mouse Anti-Human LRP‑4 Monoclonal Antibody (Catalog # MAB5948, filled histo­gram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
Species: Hu
Applications: Flow, IHC, WB
LRP2 Antibody
(CD7D5) - Azide and B ...
NB110-96417
Immunocytochemistry/Immunofluorescence: LRP2 Antibody (CD7D5) [NB110-96417] - U2OS cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.1% Saponin. The cells were incubated with anti-LRP2 (CD7D5) at 20 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: LRP2 Antibody (CD7D5) [NB110-96417] - Representative immunofluorescence stainings of control (Tead4m-z+) and Tead4 maternal/zygotic mutant (Tead4m-z-) embryos for Krt8 and Krt18 (16 cell stage embryos) and Lrp2 and Dab2 (32 to 64 cell stage embryos; Lrp2 and Dab2 were not detected in earlier stage embryos). n indicates total number of embryos analyzed. Scale bar: 25 um. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/22906), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LRP2 Antibody (CD7D5) [NB110-96417] - Analysis of a FFPE tissue section of mouse kidney using 1:200 dilution of LRP2 [CD7D5] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Apolipoprotein E
R2/ApoE R2 Antibody
NB100-2216
Western Blot: Apolipoprotein E R2/ApoE R2 Antibody [NB100-2216] - Analysis of ApoER2 on mouse brain membrane.
Immunocytochemistry/Immunofluorescence: Apolipoprotein E R2/ApoE R2 Antibody [NB100-2216] - Antibody was tested in Neuro-2a cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(5 Publications)
Species: Ch, Hu, Mu
Applications: ICC/IF, PAGE, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(29 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
VLDLR Antibody
(6A6) - BSA Free
NBP1-78162
Western Blot: VLDLR Antibody (6A6) [NBP1-78162] - MCF-7 cells were exposed to 20% or 1% O2 for 48 hours, whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. VLDLR Antibody (NBP1-78162) antibody at 1:1000, 4C, overnight. WB image submitted by a verifed customer review.
Immunocytochemistry/Immunofluorescence: VLDLR Antibody (6A6) [NBP1-78162] - VLDL R Antibody (6A6) [NBP1-78162] - VLDL Receptor antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: VLDL R Antibody (6A6) [NBP1-78162] - Analysis of VLDL Receptor in mouse kidney.
(1 Review)
(7 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
uPAR [HRP]
DUP00
(41 Publications)
Species: Hu
Applications: ELISA
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Recombinant Human u-Plasminogen Activator/Urokinase (Catalog # 1310-SE) is measured by its ability to cleave a peptide substrate,N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC).
(11 Publications)
Species: Hu
Applications: EnzAct
LRP-1B Antibody
NBP2-76566
LRP-1B Antibody
Species: Hu
Applications: ICC/IF

Publications for LRP-1B Antibody (NBP2-76566) (0)

There are no publications for LRP-1B Antibody (NBP2-76566).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP-1B Antibody (NBP2-76566) (0)

There are no reviews for LRP-1B Antibody (NBP2-76566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRP-1B Antibody (NBP2-76566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRP-1B Products

Bioinformatics Tool for LRP-1B Antibody (NBP2-76566)

Discover related pathways, diseases and genes to LRP-1B Antibody (NBP2-76566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP-1B Antibody (NBP2-76566)

Discover more about diseases related to LRP-1B Antibody (NBP2-76566).
 

Pathways for LRP-1B Antibody (NBP2-76566)

View related products by pathway.

PTMs for LRP-1B Antibody (NBP2-76566)

Learn more about PTMs related to LRP-1B Antibody (NBP2-76566).
 

Research Areas for LRP-1B Antibody (NBP2-76566)

Find related products by research area.

Blogs on LRP-1B

There are no specific blogs for LRP-1B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRP-1B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LRP1B