LRP-1B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LRP-1B Antibody [NBP2-76566] - Staining of human cell line HEK 293 shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRP-1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQANSGLICPEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRP1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87)%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, containing 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LRP-1B Antibody - BSA Free

• EC 1.1.1.94
• EC 3.4.21.9
• low density lipoprotein receptor related protein-deleted in tumor
• low density lipoprotein receptor-related protein 1B
• low density lipoprotein-related protein 1B (deleted in tumors)
• Low-density lipoprotein receptor-related protein-deleted in tumor
• LRP1B
• LRP-1B
• LRP-deleted in tumors
• LRPDIT
• LRP-DIT
• LRP-DITlow-density lipoprotein receptor-related protein 1B

Background

LRP1B - low density lipoprotein-related protein 1B (deleted in tumors)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRP1B