Recombinant Human LOXL4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LOXL4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 657-755 of Human LOXL4

Source: Wheat Germ

Amino Acid Sequence: ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LOXL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LOXL4 Protein

  • EC 1.4.3
  • EC 1.4.3.-
  • FLJ21889
  • LOXClysyl oxidase related C
  • lysyl oxidase homolog 4
  • lysyl oxidase-like 4
  • Lysyl oxidase-like protein 4
  • Lysyl oxidase-related protein C

Background

LOXL4 - lysyl oxidase-like 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82827
Species: Hu
Applications: IHC, IHC-P
NBP1-32954
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5170
Species: Hu
Applications: WB, Simple Western, Block
NBP2-65171
Species: Hu
H00084171-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for LOXL4 Partial Recombinant Protein (H00084171-Q01) (0)

There are no publications for LOXL4 Partial Recombinant Protein (H00084171-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LOXL4 Partial Recombinant Protein (H00084171-Q01) (0)

There are no reviews for LOXL4 Partial Recombinant Protein (H00084171-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LOXL4 Partial Recombinant Protein (H00084171-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LOXL4 Products

Bioinformatics Tool for LOXL4 Partial Recombinant Protein (H00084171-Q01)

Discover related pathways, diseases and genes to LOXL4 Partial Recombinant Protein (H00084171-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LOXL4 Partial Recombinant Protein (H00084171-Q01)

Discover more about diseases related to LOXL4 Partial Recombinant Protein (H00084171-Q01).
 

Pathways for LOXL4 Partial Recombinant Protein (H00084171-Q01)

View related products by pathway.

PTMs for LOXL4 Partial Recombinant Protein (H00084171-Q01)

Learn more about PTMs related to LOXL4 Partial Recombinant Protein (H00084171-Q01).
 

Research Areas for LOXL4 Partial Recombinant Protein (H00084171-Q01)

Find related products by research area.

Blogs on LOXL4

There are no specific blogs for LOXL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LOXL4 Antibody (4H7)
H00084171-M01
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LOXL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LOXL4