LOXL1 Antibody (4H3V8)

Western Blot: LOXL1 Antibody (4H3V8) [NBP3-33394] - Western blot analysis of various lysates, using LOXL1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4H3V8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

LOXL1 Antibody (4H3V8) Summary

• Description: Novus Biologicals Rabbit LOXL1 Antibody (4H3V8) (NBP3-33394) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 95-370 of human LOXL1 (NP_005567.2).
  
  Sequence:
  RQAPSLPLPGRVGSDTVRGQARHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYPQAPFVSQYENYDPASRTYDQGFVYYRPAGGGVGAGAAAVASAGVIYPYQPRARYEEYGGGEELPEYPPQGFYPAPERPYVPPPPPPPDGLDRRYSHSLYSEGTPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNGRGLP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: LOXL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for LOXL1 Antibody (4H3V8)

• EC 1.4.3.13
• LOLEC 1.4.3
• LOXL
• LOXL1
• LOXLEC 1.4.3.-
• Lysyl Oxidase Homolog 1
• Lysyl Oxidase like 1
• lysyl oxidase-like 1
• Lysyl oxidase-like protein 1

Background

The LOXL1 gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LOXL1