LNX2 Antibody - BSA Free

Western Blot: LNX2 Antibody [NBP2-87734] - Host: Rabbit. Target Name: LNX2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LNX2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LNX2. Peptide sequence: LRERRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LNX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LNX2 Antibody - BSA Free

• FLJ23932
• FLJ38000
• ligand of Numb protein X 2
• ligand of numb-protein X 2
• MGC46315
• Numb-binding protein 2
• PDZ domain containing ring finger 1
• PDZ domain-containing RING finger protein 1
• PDZRN1FLJ12933

Background

LNX2, also known as Ligand of Numb protein X 2, is a 76 kDa, 690 amino acid protein that is involved in interacting with phosphotyrosine as a component of NUMB. Diseases and disorders such as endocarditis and Q fever are being researched with this disease. The protein interacts with UBE21, NUMB, CD8A, LNX1, and E4F1 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LNX2