LNX2 Antibody

Images

 
Western Blot: LNX2 Antibody [NBP2-87734] - Host: Rabbit. Target Name: LNX2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LNX2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LNX2. Peptide sequence: LRERRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LNX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LNX2 Antibody

  • FLJ23932
  • FLJ38000
  • ligand of Numb protein X 2
  • ligand of numb-protein X 2
  • MGC46315
  • Numb-binding protein 2
  • PDZ domain containing ring finger 1
  • PDZ domain-containing RING finger protein 1
  • PDZRN1FLJ12933

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80518
Species: Hu
Applications: WB
NBP1-81441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19762
Species: Hu
Applications: WB, IHC, IHC-P
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP1-88192
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-88136
Species: Hu
Applications: WB (-), IP
NBP1-47935
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF1213
Species: Mu
Applications: WB, IHC, Block, ICC
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LNX2 Antibody (NBP2-87734) (0)

There are no publications for LNX2 Antibody (NBP2-87734).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LNX2 Antibody (NBP2-87734) (0)

There are no reviews for LNX2 Antibody (NBP2-87734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LNX2 Antibody (NBP2-87734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LNX2 Products

Bioinformatics Tool for LNX2 Antibody (NBP2-87734)

Discover related pathways, diseases and genes to LNX2 Antibody (NBP2-87734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LNX2 Antibody (NBP2-87734)

Discover more about diseases related to LNX2 Antibody (NBP2-87734).
 

Pathways for LNX2 Antibody (NBP2-87734)

View related products by pathway.

Research Areas for LNX2 Antibody (NBP2-87734)

Find related products by research area.

Blogs on LNX2

There are no specific blogs for LNX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LNX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LNX2