Lnx1 Antibody

Western Blot: Lnx1 Antibody [NBP1-80518] - Host: Rabbit. Target Name: LNX1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: Lnx1 Antibody [NBP1-80518] - Transfected 293T cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Lnx1 Antibody Summary

• Immunogen: Synthetic peptide directed towards the C terminal of human LNX1. Peptide sequence SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LNX1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against LNX1 and was validated on Western blot.
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Lnx1 Antibody

• EC 6.3.2.-
• ligand of numb-protein X 1ligand of numb-protein X
• LNXmulti-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX
• MPDZ
• Numb-binding protein 1
• PDZ domain-containing ring finger protein 2
• PDZRN2E3 ubiquitin-protein ligase LNX

Background

Lnx1 encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LNX1
• Uniprot:
  • NP_116011(Human)