Lnx1 Antibody

Images

 
Western Blot: Lnx1 Antibody [NBP1-80518] - Host: Rabbit. Target Name: LNX1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: Lnx1 Antibody [NBP1-80518] - Transfected 293T cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lnx1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human LNX1. Peptide sequence SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LNX1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LNX1 and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Lnx1 Antibody

  • EC 6.3.2.-
  • ligand of numb-protein X 1ligand of numb-protein X
  • LNXmulti-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX
  • MPDZ
  • Numb-binding protein 1
  • PDZ domain-containing ring finger protein 2
  • PDZRN2E3 ubiquitin-protein ligase LNX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-81441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81069
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1354
Species: Hu
Applications: Flow, PEP-ELISA, IF
NBP1-88192
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19762
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83716
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P
NB100-88136
Species: Hu
Applications: WB (-), IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-80518
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for Lnx1 Antibody (NBP1-80518) (0)

There are no publications for Lnx1 Antibody (NBP1-80518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lnx1 Antibody (NBP1-80518) (0)

There are no reviews for Lnx1 Antibody (NBP1-80518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lnx1 Antibody (NBP1-80518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Lnx1 Products

Bioinformatics Tool for Lnx1 Antibody (NBP1-80518)

Discover related pathways, diseases and genes to Lnx1 Antibody (NBP1-80518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lnx1 Antibody (NBP1-80518)

Discover more about diseases related to Lnx1 Antibody (NBP1-80518).
 

Pathways for Lnx1 Antibody (NBP1-80518)

View related products by pathway.

PTMs for Lnx1 Antibody (NBP1-80518)

Learn more about PTMs related to Lnx1 Antibody (NBP1-80518).
 

Research Areas for Lnx1 Antibody (NBP1-80518)

Find related products by research area.

Blogs on Lnx1

There are no specific blogs for Lnx1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lnx1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LNX1
Uniprot