LMX1A Antibody

Product Discontinued

LMX1A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLT
• Predicted Species: Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LMX1A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LMX1A Antibody

• LIM homeobox transcription factor 1, alpha
• LMX1.1

Background

Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al., 1994 [PubMed 7698771]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LMX1A Antibody (NBP1-81303)(2)

Publications using NBP1-81303

• Lin CY, Erkek S, Tong Y et al. Active medulloblastoma enhancers reveal subgroup-specific cellular origins Nature 2016-02-04 [PMID: 26814967] (IHC-P, Zebrafish)
• Ariadna Laguna, Nicoletta Schintu, Andre Nobre et al. Dopaminergic control of autophagic-lysosomal function implicates Lmx1b in Parkinsons disease. Nature Neuroscience 2015-04-27 [PMID: 25915474] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: LMX1A