LMP2/PSMB9 Recombinant Protein Antigen

Images

 
There are currently no images for LMP2/PSMB9 Protein (NBP2-33681PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LMP2/PSMB9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB9.

Source: E. coli

Amino Acid Sequence: GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMB9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33681.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMP2/PSMB9 Recombinant Protein Antigen

  • beta1i
  • LMP2
  • LMP2MGC70470
  • Low molecular mass protein 2
  • Macropain chain 7
  • Multicatalytic endopeptidase complex chain 7
  • proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2)
  • proteasome catalytic subunit 1i
  • Proteasome chain 7
  • proteasome subunit beta 6i
  • proteasome subunit beta type-9
  • Proteasome subunit beta-1i
  • proteasome-related gene 2
  • PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2)
  • PSMB9
  • Really interesting new gene 12 protein
  • RING12
  • RING12EC 3.4.25.1

Background

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. LMP2 is a catalytic subunit of the 20S proteasome and, upon interferon gamma-induction, replaces the delta subunit. LMP2 alters the specificity of the 20S proteasome and is critical for the production of MHC class I ligands, production of T-lymphocytes, and is suggested to increase the efficiency of antigen presentation of the immune response. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis (CF transmembrane regulator), Angelman's syndrome (E6-AP), and Liddle syndrome (endothelial sodium channels).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
485-MI
Species: Mu
Applications: BA
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-83121
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-86968
Species: Hu
Applications: IHC,  IHC-P
NBP2-13820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-64775
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
NBP2-33681PEP
Species: Hu
Applications: AC

Publications for LMP2/PSMB9 Protein (NBP2-33681PEP) (0)

There are no publications for LMP2/PSMB9 Protein (NBP2-33681PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMP2/PSMB9 Protein (NBP2-33681PEP) (0)

There are no reviews for LMP2/PSMB9 Protein (NBP2-33681PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LMP2/PSMB9 Protein (NBP2-33681PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMP2/PSMB9 Products

Research Areas for LMP2/PSMB9 Protein (NBP2-33681PEP)

Find related products by research area.

Blogs on LMP2/PSMB9

There are no specific blogs for LMP2/PSMB9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMP2/PSMB9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB9